eF-site ID 2jzw_1-AB
PDB Code 2jzw
Model 1
Chain A, B

click to enlarge
Title How the HIV-1 nucleocapsid protein binds and destabilises the (-)primer binding site during reverse transcription
Classification VIRAL PROTEIN/DNA
Compound HIV-1 nucleocapsid protein NCp7(12-55)
Source (2JZW)
Sequence A:  NVKCFNCGKEGHTARNCRAPRKKGCWKCGKEGHQMKDCTE
RQAN
B:  GTCCCTGTTCGGGC
Description (1)  HIV-1 nucleocapsid protein NCp7(12-55)/DNA Complex


Functional site

1) chain A
residue 15
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 56
source : AC1

2) chain A
residue 18
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 56
source : AC1

3) chain A
residue 23
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 56
source : AC1

4) chain A
residue 36
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

5) chain A
residue 39
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

6) chain A
residue 41
type
ligand
sequence K
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

7) chain A
residue 44
type
ligand
sequence H
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

8) chain A
residue 45
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE ZN A 57
source : AC2

9) chain B
residue 103-114
type prosite
ligand
sequence CCCTGTTCGGGC
description EGF-like domain signature 1. C-x-C-x(2)-{V}-x(2)-G-{C}-x-C
source prosite : PS00022

10) chain A
residue 15-20
type binding
ligand ZN: ZINC ION
sequence CFNCGK
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_56

11) chain A
residue 23-25
type binding
ligand ZN: ZINC ION
sequence HTA
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_56

12) chain A
residue 28
type binding
ligand ZN: ZINC ION
sequence C
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_56

13) chain A
residue 30
type binding
ligand ZN: ZINC ION
sequence A
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_56

14) chain A
residue 29
type binding
ligand ZN: ZINC ION
sequence R
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_56

15) chain A
residue 27
type binding
ligand ZN: ZINC ION
sequence N
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_56

16) chain A
residue 36
type binding
ligand ZN: ZINC ION
sequence C
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

17) chain A
residue 38-41
type binding
ligand ZN: ZINC ION
sequence KCGK
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

18) chain A
residue 44-46
type binding
ligand ZN: ZINC ION
sequence HQM
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

19) chain A
residue 49
type binding
ligand ZN: ZINC ION
sequence C
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

20) chain A
residue 51
type binding
ligand ZN: ZINC ION
sequence E
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

21) chain A
residue 53
type binding
ligand ZN: ZINC ION
sequence Q
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

22) chain A
residue 50
type binding
ligand ZN: ZINC ION
sequence T
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

23) chain A
residue 52
type binding
ligand ZN: ZINC ION
sequence R
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57

24) chain A
residue 48
type binding
ligand ZN: ZINC ION
sequence D
description ZINC ION binding site
source pdb_hetatom : ZN_2jzw_A_57


Display surface

Download
Links