eF-site ID 2jz7_4-E
PDB Code 2jz7
Model 4
Chain E

click to enlarge
Title Solution NMR structure of selenium-binding protein from Methanococcus Vannielii
Classification Selenium-Binding Protein
Compound Selenium binding protein
Source Methanococcus vannielii (Q5UBU1_METVA)
Sequence E:  MIFEDKFIITTADEIPGLQLYSLGIASTISDNVDEIVENL
RKQVKAKGGMGLIAFRITCADGKFLGYGTIVKADEAQFTM
A
Description (1)  Selenium binding protein

Display surface

Download
Links