eF-site ID 2jmn_16-B
PDB Code 2jmn
Model 16
Chain B

click to enlarge
Title NMR structure of human insulin mutant His-B10-Asp, Pro-B28-Lys, Lys-B29-Pro, 20 structures
Classification HORMONE/GROWTH FACTOR
Compound Insulin A chain
Source Homo sapiens (Human) (INS_HUMAN)
Sequence B:  FVNQHLCGSDLVEALYLVCGERGFFYTKPT
Description (1)  Insulin A chain, Insulin B chain

Display surface

Download
Links