eF-site ID 2jkp-A PDB Code 2jkp Chain A click to enlarge Title Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine Classification HYDROLASE Compound ALPHA-GLUCOSIDASE (ALPHA-GLUCOSIDASE SUSB) Source Bacteroides thetaiotaomicron (P71094_BACTN) Sequence A:  QQKLTSPDNNLVMTFQVDSKGAPTYELTYKNKVVIKPSTL GLELKKEDSKTNLYDGFEVKDTQTATFDETWQPVWGEEKE IRNHYNELAVTLYQPMNDRSIVIRFRLFNDGLGFRYEFPQ QKSLNYFVIKEEHSQFGMNGDHIAFWIPGDYDTQEYDYTI SRLSEIRGLMKEAITPNSSQTPFSQTGVQTALMMKTDDGL YINLHEAALVDYSCMHLNLDDKNMVFESWLTPDAKGDKGY MQTPCNTPWRTIIVSDDARNILASRITLNLNEPCKIADAA SWVKPVKYIGVWWDMITGKGSWAYTDELTSVKLGETDYSK TKPNGKHSANTANVKRYIDFAAAHGFDAVLVEGWNEGWED WFGNSKDYVFDFVTPYPDFDVKEIHRYAARKGIKMMMHHE TSASVRNYERHMDKAYQFMADNGYNSVKSGYVGNIIPRGE HHYGQWMNNHYLYAVKKAADYKIMVNAHEATRPTGICRTY PNLIGNESARGTEYESFGGNKVYHTTILPFTRLVGGPMDY TPGIFETHCNKMNPANNSQVRSTIARQLALYVTMYSPLQM AADIPENYERFMDAFQFIKDVALDWDETNYLEAEPGEYIT IARKAKDTDDWYVGCTAGENGHTSKLVFDFLTPGKQYIAT VYADAKDADWKENPQAYTIKKGILTNKSKLNLHAANGGGY AISIKEV Description Functional site 1) chain A residue 331 type sequence W description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 2) chain A residue 335 type sequence I description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 3) chain A residue 341 type sequence W description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 4) chain A residue 391 type sequence E description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 5) chain A residue 397 type sequence W description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 6) chain A residue 400 type sequence W description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 7) chain A residue 437 type sequence H description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 8) chain A residue 439 type sequence E description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 9) chain A residue 467 type sequence K description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 10) chain A residue 471 type sequence V description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 11) chain A residue 507 type sequence H description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 12) chain A residue 508 type sequence E description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 13) chain A residue 526 type sequence E description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 14) chain A residue 532 type sequence E description BINDING SITE FOR RESIDUE CTS A1727 source : AC1 15) chain A residue 194 type sequence E description BINDING SITE FOR RESIDUE CA A1728 source : AC4 16) chain A residue 508 type sequence E description BINDING SITE FOR RESIDUE CA A1728 source : AC4 17) chain A residue 526 type sequence E description BINDING SITE FOR RESIDUE CA A1728 source : AC4 18) chain A residue 532 type sequence E description BINDING SITE FOR RESIDUE CA A1728 source : AC4 19) chain A residue 112 type sequence P description BINDING SITE FOR RESIDUE EDO A1729 source : AC5 20) chain A residue 113 type sequence V description BINDING SITE FOR RESIDUE EDO A1729 source : AC5 21) chain A residue 114 type sequence W description BINDING SITE FOR RESIDUE EDO A1729 source : AC5 22) chain A residue 516 type sequence C description BINDING SITE FOR RESIDUE EDO A1729 source : AC5 23) chain A residue 520 type sequence P description BINDING SITE FOR RESIDUE EDO A1729 source : AC5 24) chain A residue 333 type sequence D description BINDING SITE FOR RESIDUE EDO A1730 source : AC6 25) chain A residue 338 type sequence K description BINDING SITE FOR RESIDUE EDO A1730 source : AC6 26) chain A residue 372 type sequence N description BINDING SITE FOR RESIDUE EDO A1730 source : AC6 27) chain A residue 376 type sequence Y description BINDING SITE FOR RESIDUE EDO A1730 source : AC6 28) chain A residue 603 type sequence I description BINDING SITE FOR RESIDUE EDO A1730 source : AC6 29) chain A residue 194 type SITE sequence E description Substrate source Swiss-Prot : SWS_FT_FI4 30) chain A residue 331 type SITE sequence W description Substrate source Swiss-Prot : SWS_FT_FI4 31) chain A residue 467 type SITE sequence K description Substrate source Swiss-Prot : SWS_FT_FI4 32) chain A residue 194 type BINDING sequence E description BINDING => ECO:0000269|PubMed:18981178 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 508 type BINDING sequence E description BINDING => ECO:0000269|PubMed:18981178 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 526 type BINDING sequence E description BINDING => ECO:0000269|PubMed:18981178 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 532 type BINDING sequence E description BINDING => ECO:0000269|PubMed:18981178 source Swiss-Prot : SWS_FT_FI2 36) chain A residue 215 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI3 37) chain A residue 437 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI3 38) chain A residue 507 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI3 39) chain A residue 532 type ACT_SITE sequence E description Proton donor/acceptor => ECO:0000305|PubMed:18981178 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links