eF-site ID 2jjn-A PDB Code 2jjn Chain A click to enlarge Title Structure of closed cytochrome P450 EryK Classification OXIDOREDUCTASE Compound CYTOCHROME P450 113A1 Source null (CPXQ_SACEN) Sequence A:  TIDEVPGMADETALLDWLGTMREKQPVWQDRYGVWHVFRH ADVQTVLRDTATFSSDPTRVIEGASPTPGMIHEIDPPEHR ALRKVVSSAFTPRTISDLEPRIRDVTRSLLADAGESFDLV DVLAFPLPVTIVAELLGLPPMDHEQFGDWSGALVDIQMDD PTDPALAERIADVLNPLTAYLKARCAERRADPGDDLISRL VLAEVDGRALDDEEAANFSTALLLAGHITTTVLLGNIVRT LDEHPAHWDAAAEDPGRIPAIVEEVLRYRPPFPQMQRTTT KATEVAGVPIPADVMVNTWVLSANRDSDAHDDPDRFDPSR KSGGAAQLSFGHGVHFCLGAPLARLENRVALEEIIARFGR LTVDRDDERLRHFEQIVLGTRHLPVLAGSSPRQSA Description Functional site 1) chain A residue 87 type sequence I description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 2) chain A residue 88 type sequence H description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 3) chain A residue 95 type sequence H description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 4) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 5) chain A residue 106 type sequence F description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 6) chain A residue 238 type sequence L description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 7) chain A residue 241 type sequence A description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 8) chain A residue 242 type sequence G description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 9) chain A residue 245 type sequence T description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 10) chain A residue 246 type sequence T description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 11) chain A residue 249 type sequence L description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 12) chain A residue 291 type sequence M description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 13) chain A residue 293 type sequence R description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 14) chain A residue 345 type sequence S description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 15) chain A residue 346 type sequence F description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 16) chain A residue 347 type sequence G description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 17) chain A residue 351 type sequence H description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 18) chain A residue 353 type sequence C description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 19) chain A residue 355 type sequence G description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 20) chain A residue 358 type sequence L description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 21) chain A residue 359 type sequence A description BINDING SITE FOR RESIDUE HEM A 412 source : AC1 22) chain A residue 381 type sequence R description BINDING SITE FOR RESIDUE SO4 A 413 source : AC2 23) chain A residue 385 type sequence R description BINDING SITE FOR RESIDUE SO4 A 413 source : AC2 24) chain A residue 386 type sequence L description BINDING SITE FOR RESIDUE SO4 A 413 source : AC2 25) chain A residue 388 type sequence H description BINDING SITE FOR RESIDUE SO4 A 413 source : AC2 26) chain A residue 326 type sequence H description BINDING SITE FOR RESIDUE SO4 A 414 source : AC3 27) chain A residue 327 type sequence D description BINDING SITE FOR RESIDUE SO4 A 414 source : AC3 28) chain A residue 336 type sequence R description BINDING SITE FOR RESIDUE SO4 A 414 source : AC3 29) chain A residue 338 type sequence S description BINDING SITE FOR RESIDUE SO4 A 414 source : AC3 30) chain A residue 55 type sequence R description BINDING SITE FOR RESIDUE SO4 A 415 source : AC4 31) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE SO4 A 416 source : AC5 32) chain A residue 103 type sequence S description BINDING SITE FOR RESIDUE SO4 A 416 source : AC5 33) chain A residue 354 type sequence L description BINDING SITE FOR RESIDUE SO4 A 416 source : AC5 34) chain A residue 56 type sequence H description BINDING SITE FOR RESIDUE SO4 A 417 source : AC6 35) chain A residue 326 type sequence H description BINDING SITE FOR RESIDUE SO4 A 417 source : AC6 36) chain A residue 342 type sequence A description BINDING SITE FOR RESIDUE SO4 A 417 source : AC6 37) chain A residue 344 type sequence L description BINDING SITE FOR RESIDUE SO4 A 417 source : AC6 38) chain A residue 346-355 type prosite sequence FGHGVHFCLG description CYTOCHROME_P450 Cytochrome P450 cysteine heme-iron ligand signature. FGhGVHFCLG source prosite : PS00086 39) chain A residue 353 type BINDING sequence C description axial binding residue source Swiss-Prot : SWS_FT_FI2 40) chain A residue 88 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 41) chain A residue 95 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 42) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 43) chain A residue 292 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 44) chain A residue 293 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 45) chain A residue 351 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links