eF-site ID 2jj8-ABCD PDB Code 2jj8 Chain A, B, C, D click to enlarge Title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase Classification TRANSFERASE Compound DEOXYNUCLEOSIDE KINASE Source Drosophila melanogaster (Fruit fly) (DNK_DROME) Sequence A:  TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLT EPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQS HTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT LEEWYKFIEESIHVQADLIIYLRTSPEVAYERCVPLKYLQ ELHELHEDWLIHPQSCKVLVLDAD B:  TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLT EPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQS HTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT LEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRCVPL KYLQELHELHEDWLIHQCKVLVLDAD C:  TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLT EPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQS HTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT LEEWYKFIEESIHVQADLIIYLRTSPEVAYERIPLKYLQE LHELHEDWLIHCKVLVLDAD D:  TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLT EPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQS HTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT LEEWYKFIEESIHVQADLIIYLRTSPEVAYERIRQRCVPL KYLQELHELHEDWLIHQCKVLVLDAD Description Functional site 1) chain A residue 29 type sequence I description BINDING SITE FOR RESIDUE SO4 A 1209 source : AC1 2) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1209 source : AC1 3) chain A residue 52 type sequence E description BINDING SITE FOR RESIDUE SO4 A 1209 source : AC1 4) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE SO4 A 1209 source : AC1 5) chain A residue 30 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1210 source : AC2 6) chain A residue 31 type sequence S description BINDING SITE FOR RESIDUE SO4 A 1210 source : AC2 7) chain A residue 32 type sequence G description BINDING SITE FOR RESIDUE SO4 A 1210 source : AC2 8) chain A residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 A 1210 source : AC2 9) chain A residue 34 type sequence T description BINDING SITE FOR RESIDUE SO4 A 1210 source : AC2 10) chain A residue 52 type sequence E description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 11) chain A residue 57 type sequence W description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 12) chain A residue 80 type sequence F description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 13) chain A residue 81 type sequence Q description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 14) chain A residue 84 type sequence V description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 15) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 16) chain A residue 110 type sequence A description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 17) chain A residue 114 type sequence F description BINDING SITE FOR RESIDUE AZZ A 1211 source : AC3 18) chain B residue 28 type sequence N description BINDING SITE FOR RESIDUE SO4 B 1209 source : AC4 19) chain B residue 30 type sequence G description BINDING SITE FOR RESIDUE SO4 B 1209 source : AC4 20) chain B residue 31 type sequence S description BINDING SITE FOR RESIDUE SO4 B 1209 source : AC4 21) chain B residue 32 type sequence G description BINDING SITE FOR RESIDUE SO4 B 1209 source : AC4 22) chain B residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1209 source : AC4 23) chain B residue 34 type sequence T description BINDING SITE FOR RESIDUE SO4 B 1209 source : AC4 24) chain B residue 29 type sequence I description BINDING SITE FOR RESIDUE SO4 B 1210 source : AC5 25) chain B residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 B 1210 source : AC5 26) chain B residue 52 type sequence E description BINDING SITE FOR RESIDUE SO4 B 1210 source : AC5 27) chain B residue 105 type sequence R description BINDING SITE FOR RESIDUE SO4 B 1210 source : AC5 28) chain B residue 52 type sequence E description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 29) chain B residue 57 type sequence W description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 30) chain B residue 70 type sequence Y description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 31) chain B residue 80 type sequence F description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 32) chain B residue 81 type sequence Q description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 33) chain B residue 84 type sequence V description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 34) chain B residue 105 type sequence R description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 35) chain B residue 110 type sequence A description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 36) chain B residue 114 type sequence F description BINDING SITE FOR RESIDUE AZZ B 1211 source : AC6 37) chain C residue 30 type sequence G description BINDING SITE FOR RESIDUE SO4 C 1209 source : AC7 38) chain C residue 31 type sequence S description BINDING SITE FOR RESIDUE SO4 C 1209 source : AC7 39) chain C residue 32 type sequence G description BINDING SITE FOR RESIDUE SO4 C 1209 source : AC7 40) chain C residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 C 1209 source : AC7 41) chain C residue 34 type sequence T description BINDING SITE FOR RESIDUE SO4 C 1209 source : AC7 42) chain C residue 29 type sequence I description BINDING SITE FOR RESIDUE SO4 C 1210 source : AC8 43) chain C residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 C 1210 source : AC8 44) chain C residue 52 type sequence E description BINDING SITE FOR RESIDUE SO4 C 1210 source : AC8 45) chain C residue 105 type sequence R description BINDING SITE FOR RESIDUE SO4 C 1210 source : AC8 46) chain C residue 52 type sequence E description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 47) chain C residue 57 type sequence W description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 48) chain C residue 80 type sequence F description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 49) chain C residue 81 type sequence Q description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 50) chain C residue 105 type sequence R description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 51) chain C residue 110 type sequence A description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 52) chain C residue 114 type sequence F description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 53) chain C residue 118 type sequence M description BINDING SITE FOR RESIDUE AZZ C 1211 source : AC9 54) chain D residue 28 type sequence N description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 55) chain D residue 30 type sequence G description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 56) chain D residue 31 type sequence S description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 57) chain D residue 32 type sequence G description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 58) chain D residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 59) chain D residue 34 type sequence T description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 60) chain D residue 104 type sequence E description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 61) chain D residue 167 type sequence R description BINDING SITE FOR RESIDUE SO4 D 1209 source : BC1 62) chain D residue 29 type sequence I description BINDING SITE FOR RESIDUE SO4 D 1210 source : BC2 63) chain D residue 33 type sequence K description BINDING SITE FOR RESIDUE SO4 D 1210 source : BC2 64) chain D residue 52 type sequence E description BINDING SITE FOR RESIDUE SO4 D 1210 source : BC2 65) chain D residue 105 type sequence R description BINDING SITE FOR RESIDUE SO4 D 1210 source : BC2 66) chain D residue 52 type sequence E description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 67) chain D residue 57 type sequence W description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 68) chain D residue 80 type sequence F description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 69) chain D residue 81 type sequence Q description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 70) chain D residue 84 type sequence V description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 71) chain D residue 105 type sequence R description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 72) chain D residue 110 type sequence A description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 73) chain D residue 114 type sequence F description BINDING SITE FOR RESIDUE AZZ D 1211 source : BC3 74) chain A residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 75) chain B residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 76) chain C residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 77) chain D residue 27 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 78) chain A residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 79) chain B residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 80) chain C residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 81) chain D residue 104 type ACT_SITE sequence E description Proton acceptor => ECO:0000255 source Swiss-Prot : SWS_FT_FI1 82) chain A residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 83) chain C residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 84) chain C residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 85) chain C residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 86) chain C residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 87) chain D residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 88) chain D residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 89) chain D residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 90) chain D residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 91) chain A residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 92) chain A residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 93) chain A residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3 94) chain B residue 52 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI3 95) chain B residue 70 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI3 96) chain B residue 81 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI3 97) chain B residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links