eF-site ID 2jif-A PDB Code 2jif Chain A click to enlarge Title Structure of human short-branched chain acyl-CoA dehydrogenase (ACADSB) Classification OXIDOREDUCTASE Compound SHORT/BRANCHED CHAIN SPECIFIC ACYL-COA DEHYDROGENASE Source Homo sapiens (Human) (ACDSB_HUMAN) Sequence A:  APLQTFTDEEMMIKSSVKKFAQEQIAPLVSTMDENSKMEK SVIQGLFQQGLMGIEVDPEYGGTGASFLSTVLVIEELAKV DASVAVFCEIQNTLINTLIRKHGTEEQKATYLPQLTTEKV GSFCLSEAGAGSDSFALKTRADKEGDYYVLNGSKMWISSA EHAGLFLVMANVDPTIGYKGITSFLVDRDTPGLHIGKPEN KLGLRASSTCPLTFENVKVPEANILGQIGHGYKYAIGSLN EGRIGIAAQMLGLAQGCFDYTIPYIKERIQFGKRLFDFQG LQHQVAHVATQLEAARLLTYNAARLLEAGKPFIKEASMAK YYASEIAGQTTSKCIEWMGGVGYTKDYPVEKYFRDAKIGT IYEGASNIQLNTIAKHIDAEY Description Functional site 1) chain A residue 108 type sequence D description BINDING SITE FOR RESIDUE CL A1436 source : AC1 2) chain A residue 151 type sequence R description BINDING SITE FOR RESIDUE CL A1436 source : AC1 3) chain A residue 213 type sequence H description BINDING SITE FOR RESIDUE CL A1437 source : AC2 4) chain A residue 259 type sequence S description BINDING SITE FOR RESIDUE CL A1437 source : AC2 5) chain A residue 373 type sequence Y description BINDING SITE FOR RESIDUE CL B1438 source : AC5 6) chain A residue 174 type sequence F description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 7) chain A residue 176 type sequence L description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 8) chain A residue 177 type sequence S description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 9) chain A residue 182 type sequence G description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 10) chain A residue 183 type sequence S description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 11) chain A residue 207 type sequence W description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 12) chain A residue 209 type sequence S description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 13) chain A residue 260 type sequence T description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 14) chain A residue 409 type sequence I description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 15) chain A residue 412 type sequence I description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 16) chain A residue 416 type sequence A description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 17) chain A residue 418 type sequence N description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 18) chain A residue 419 type sequence I description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 19) chain A residue 422 type sequence N description BINDING SITE FOR RESIDUE FAD A1433 source : BC2 20) chain A residue 183 type sequence S description BINDING SITE FOR RESIDUE COS A1434 source : BC3 21) chain A residue 185 type sequence S description BINDING SITE FOR RESIDUE COS A1434 source : BC3 22) chain A residue 229 type sequence Y description BINDING SITE FOR RESIDUE COS A1434 source : BC3 23) chain A residue 230 type sequence K description BINDING SITE FOR RESIDUE COS A1434 source : BC3 24) chain A residue 283 type sequence Y description BINDING SITE FOR RESIDUE COS A1434 source : BC3 25) chain A residue 287 type sequence I description BINDING SITE FOR RESIDUE COS A1434 source : BC3 26) chain A residue 290 type sequence L description BINDING SITE FOR RESIDUE COS A1434 source : BC3 27) chain A residue 291 type sequence N description BINDING SITE FOR RESIDUE COS A1434 source : BC3 28) chain A residue 294 type sequence R description BINDING SITE FOR RESIDUE COS A1434 source : BC3 29) chain A residue 413 type sequence Y description BINDING SITE FOR RESIDUE COS A1434 source : BC3 30) chain A residue 414 type sequence E description BINDING SITE FOR RESIDUE COS A1434 source : BC3 31) chain A residue 415 type sequence G description BINDING SITE FOR RESIDUE COS A1434 source : BC3 32) chain A residue 419 type sequence I description BINDING SITE FOR RESIDUE COS A1434 source : BC3 33) chain A residue 131 type sequence V description BINDING SITE FOR RESIDUE EDO A1435 source : BC4 34) chain A residue 399 type sequence P description BINDING SITE FOR RESIDUE EDO A1435 source : BC4 35) chain A residue 403 type sequence Y description BINDING SITE FOR RESIDUE EDO A1435 source : BC4 36) chain A residue 330 type sequence Q description BINDING SITE FOR RESIDUE FAD B1433 source : BC5 37) chain A residue 319 type sequence R description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 38) chain A residue 321 type sequence Q description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 39) chain A residue 322 type sequence F description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 40) chain A residue 326 type sequence L description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 41) chain A residue 329 type sequence F description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 42) chain A residue 332 type sequence L description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 43) chain A residue 387 type sequence E description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 44) chain A residue 388 type sequence W description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 45) chain A residue 391 type sequence G description BINDING SITE FOR RESIDUE FAD C1433 source : BC8 46) chain A residue 183 type BINDING sequence S description BINDING => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI3 47) chain A residue 229 type BINDING sequence Y description BINDING => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI3 48) chain A residue 283 type BINDING sequence Y description BINDING => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI3 49) chain A residue 291 type BINDING sequence N description BINDING => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI3 50) chain A residue 319 type BINDING sequence R description BINDING => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI3 51) chain A residue 330 type BINDING sequence Q description BINDING => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI3 52) chain A residue 387 type BINDING sequence E description BINDING => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI3 53) chain A residue 70 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:Q9DBL1 source Swiss-Prot : SWS_FT_FI4 54) chain A residue 284 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:Q9DBL1 source Swiss-Prot : SWS_FT_FI4 55) chain A residue 174 type BINDING sequence F description in other chain => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI2 56) chain A residue 207 type BINDING sequence W description in other chain => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI2 57) chain A residue 416 type BINDING sequence A description in other chain => ECO:0000269|Ref.15 source Swiss-Prot : SWS_FT_FI2 58) chain A residue 183 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI5 59) chain A residue 426 type MOD_RES sequence K description N6-acetyllysine => ECO:0000250|UniProtKB:Q9DBL1 source Swiss-Prot : SWS_FT_FI6 60) chain A residue 175-187 type prosite sequence CLSEAGAGSDSFA description ACYL_COA_DH_1 Acyl-CoA dehydrogenases signature 1. CLSEagAGSDsfA source prosite : PS00072 61) chain A residue 387-406 type prosite sequence EWMGGVGYTKDYPVEKYFRD description ACYL_COA_DH_2 Acyl-CoA dehydrogenases signature 2. EwMGGvGYtkDypveKyfrD source prosite : PS00073 62) chain A residue 414 type ACT_SITE sequence E description Proton acceptor => ECO:0000305|Ref.15 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links