eF-site ID 2ji3-C PDB Code 2ji3 Chain C click to enlarge Title X-ray structure of the iron-peroxide intermediate of superoxide reductase (E114A mutant) from Desulfoarculus baarsii Classification OXIDOREDUCTASE Compound Desulfoferrodoxin Source (DFX_DESB2) Sequence C:  MPERLQVYKCEVCGNIVEVLNGGIGELVCCNQDMKLMSEN TVDAAKEKHVPVIEKIDGGYKVKVGAVAHPMEEKHYIQWI ELLADDKCYTQFLKPGQAPEAVFLIEAAKVVARAYCNIHG HWKAEN Description Functional site 1) chain C residue 26 type sequence E description BINDING SITE FOR RESIDUE CA A1129 source : AC3 2) chain C residue 26 type sequence E description BINDING SITE FOR RESIDUE CA A1130 source : AC4 3) chain C residue 33 type sequence D description BINDING SITE FOR RESIDUE CA A1130 source : AC4 4) chain C residue 10 type sequence C description BINDING SITE FOR RESIDUE FE C1127 source : AC9 5) chain C residue 13 type sequence C description BINDING SITE FOR RESIDUE FE C1127 source : AC9 6) chain C residue 29 type sequence C description BINDING SITE FOR RESIDUE FE C1127 source : AC9 7) chain C residue 30 type sequence C description BINDING SITE FOR RESIDUE FE C1127 source : AC9 8) chain C residue 49 type sequence H description BINDING SITE FOR RESIDUE FE C1128 source : BC1 9) chain C residue 69 type sequence H description BINDING SITE FOR RESIDUE FE C1128 source : BC1 10) chain C residue 75 type sequence H description BINDING SITE FOR RESIDUE FE C1128 source : BC1 11) chain C residue 116 type sequence C description BINDING SITE FOR RESIDUE FE C1128 source : BC1 12) chain C residue 119 type sequence H description BINDING SITE FOR RESIDUE FE C1128 source : BC1 13) chain C residue 18 type sequence E description BINDING SITE FOR RESIDUE CA C1129 source : BC2 14) chain C residue 49 type sequence H description BINDING SITE FOR RESIDUE PER C1130 source : BC6 15) chain C residue 69 type sequence H description BINDING SITE FOR RESIDUE PER C1130 source : BC6 16) chain C residue 75 type sequence H description BINDING SITE FOR RESIDUE PER C1130 source : BC6 17) chain C residue 119 type sequence H description BINDING SITE FOR RESIDUE PER C1130 source : BC6 18) chain C residue 10 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 19) chain C residue 13 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 20) chain C residue 29 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 21) chain C residue 30 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 22) chain C residue 49 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 23) chain C residue 69 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 24) chain C residue 75 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 25) chain C residue 116 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 26) chain C residue 119 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links