eF-site ID 2ji3-A PDB Code 2ji3 Chain A click to enlarge Title X-ray structure of the iron-peroxide intermediate of superoxide reductase (E114A mutant) from Desulfoarculus baarsii Classification OXIDOREDUCTASE Compound Desulfoferrodoxin Source (DFX_DESB2) Sequence A:  MPERLQVYKCEVCGNIVEVLNGGIGELVCCNQDMKLMSEN TVDAAKEKHVPVIEKIDGGYKVKVGAVAHPMEEKHYIQWI ELLADDKCYTQFLKPGQAPEAVFLIEAAKVVARAYCNIHG HWKAEN Description Functional site 1) chain A residue 10 type sequence C description BINDING SITE FOR RESIDUE FE A1127 source : AC1 2) chain A residue 13 type sequence C description BINDING SITE FOR RESIDUE FE A1127 source : AC1 3) chain A residue 29 type sequence C description BINDING SITE FOR RESIDUE FE A1127 source : AC1 4) chain A residue 30 type sequence C description BINDING SITE FOR RESIDUE FE A1127 source : AC1 5) chain A residue 49 type sequence H description BINDING SITE FOR RESIDUE FE A1128 source : AC2 6) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE FE A1128 source : AC2 7) chain A residue 75 type sequence H description BINDING SITE FOR RESIDUE FE A1128 source : AC2 8) chain A residue 116 type sequence C description BINDING SITE FOR RESIDUE FE A1128 source : AC2 9) chain A residue 119 type sequence H description BINDING SITE FOR RESIDUE FE A1128 source : AC2 10) chain A residue 33 type sequence D description BINDING SITE FOR RESIDUE CA A1129 source : AC3 11) chain A residue 33 type sequence D description BINDING SITE FOR RESIDUE CA A1130 source : AC4 12) chain A residue 48 type sequence K description BINDING SITE FOR RESIDUE NO3 A1131 source : AC5 13) chain A residue 49 type sequence H description BINDING SITE FOR RESIDUE NO3 A1131 source : AC5 14) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE NO3 A1131 source : AC5 15) chain A residue 70 type sequence P description BINDING SITE FOR RESIDUE NO3 A1131 source : AC5 16) chain A residue 75 type sequence H description BINDING SITE FOR RESIDUE NO3 A1131 source : AC5 17) chain A residue 119 type sequence H description BINDING SITE FOR RESIDUE NO3 A1131 source : AC5 18) chain A residue 10 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 19) chain A residue 13 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 20) chain A residue 29 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 21) chain A residue 30 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 22) chain A residue 49 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 23) chain A residue 69 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 24) chain A residue 75 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 25) chain A residue 116 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 26) chain A residue 119 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links