eF-site ID 2ji2-D PDB Code 2ji2 Chain D click to enlarge Title X-ray structure of E114A mutant of superoxide reductase from Desulfoarculus baarsii in the native, reduced form Classification OXIDOREDUCTASE Compound Desulfoferrodoxin Source (DFX_DESB2) Sequence D:  PERLQVYKCEVCGNIVEVLNGGIGELVCCNQDMKLMSENT VDAAKEKHVPVIEKIDGGYKVKVGAVAHPMEEKHYIQWIE LLADDKCYTQFLKPGQAPEAVFLIEAAKVVARAYCNIHGH WKAEN Description Functional site 1) chain D residue 10 type sequence C description BINDING SITE FOR RESIDUE FE D1003 source : BC5 2) chain D residue 13 type sequence C description BINDING SITE FOR RESIDUE FE D1003 source : BC5 3) chain D residue 29 type sequence C description BINDING SITE FOR RESIDUE FE D1003 source : BC5 4) chain D residue 30 type sequence C description BINDING SITE FOR RESIDUE FE D1003 source : BC5 5) chain D residue 48 type sequence K description BINDING SITE FOR RESIDUE NO3 D1127 source : BC6 6) chain D residue 49 type sequence H description BINDING SITE FOR RESIDUE NO3 D1127 source : BC6 7) chain D residue 69 type sequence H description BINDING SITE FOR RESIDUE NO3 D1127 source : BC6 8) chain D residue 70 type sequence P description BINDING SITE FOR RESIDUE NO3 D1127 source : BC6 9) chain D residue 75 type sequence H description BINDING SITE FOR RESIDUE NO3 D1127 source : BC6 10) chain D residue 119 type sequence H description BINDING SITE FOR RESIDUE NO3 D1127 source : BC6 11) chain D residue 49 type sequence H description BINDING SITE FOR RESIDUE FE2 D1128 source : BC7 12) chain D residue 69 type sequence H description BINDING SITE FOR RESIDUE FE2 D1128 source : BC7 13) chain D residue 75 type sequence H description BINDING SITE FOR RESIDUE FE2 D1128 source : BC7 14) chain D residue 116 type sequence C description BINDING SITE FOR RESIDUE FE2 D1128 source : BC7 15) chain D residue 119 type sequence H description BINDING SITE FOR RESIDUE FE2 D1128 source : BC7 16) chain D residue 10 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 17) chain D residue 13 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 18) chain D residue 29 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 19) chain D residue 30 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 20) chain D residue 49 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 21) chain D residue 69 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 22) chain D residue 75 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 23) chain D residue 116 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 24) chain D residue 119 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links