eF-site ID 2ji2-C PDB Code 2ji2 Chain C click to enlarge Title X-ray structure of E114A mutant of superoxide reductase from Desulfoarculus baarsii in the native, reduced form Classification OXIDOREDUCTASE Compound Desulfoferrodoxin Source (DFX_DESB2) Sequence C:  MPERLQVYKCEVCGNIVEVLNGGIGELVCCNQDMKLMSEN TVDAAKEKHVPVIEKIDGGYKVKVGAVAHPMEEKHYIQWI ELLADDKCYTQFLKPGQAPEAVFLIEAAKVVARAYCNIHG HWKAEN Description Functional site 1) chain C residue 10 type sequence C description BINDING SITE FOR RESIDUE FE C1002 source : AC8 2) chain C residue 13 type sequence C description BINDING SITE FOR RESIDUE FE C1002 source : AC8 3) chain C residue 29 type sequence C description BINDING SITE FOR RESIDUE FE C1002 source : AC8 4) chain C residue 30 type sequence C description BINDING SITE FOR RESIDUE FE C1002 source : AC8 5) chain C residue 48 type sequence K description BINDING SITE FOR RESIDUE NO3 C1127 source : AC9 6) chain C residue 49 type sequence H description BINDING SITE FOR RESIDUE NO3 C1127 source : AC9 7) chain C residue 69 type sequence H description BINDING SITE FOR RESIDUE NO3 C1127 source : AC9 8) chain C residue 70 type sequence P description BINDING SITE FOR RESIDUE NO3 C1127 source : AC9 9) chain C residue 75 type sequence H description BINDING SITE FOR RESIDUE NO3 C1127 source : AC9 10) chain C residue 119 type sequence H description BINDING SITE FOR RESIDUE NO3 C1127 source : AC9 11) chain C residue 18 type sequence E description BINDING SITE FOR RESIDUE CA C1128 source : BC1 12) chain C residue 26 type sequence E description BINDING SITE FOR RESIDUE CA C1129 source : BC2 13) chain C residue 33 type sequence D description BINDING SITE FOR RESIDUE CA C1129 source : BC2 14) chain C residue 26 type sequence E description BINDING SITE FOR RESIDUE CA C1130 source : BC3 15) chain C residue 49 type sequence H description BINDING SITE FOR RESIDUE FE2 C1131 source : BC4 16) chain C residue 69 type sequence H description BINDING SITE FOR RESIDUE FE2 C1131 source : BC4 17) chain C residue 75 type sequence H description BINDING SITE FOR RESIDUE FE2 C1131 source : BC4 18) chain C residue 116 type sequence C description BINDING SITE FOR RESIDUE FE2 C1131 source : BC4 19) chain C residue 119 type sequence H description BINDING SITE FOR RESIDUE FE2 C1131 source : BC4 20) chain C residue 10 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 21) chain C residue 13 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 22) chain C residue 29 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 23) chain C residue 30 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 24) chain C residue 49 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 25) chain C residue 69 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 26) chain C residue 75 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 27) chain C residue 116 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 28) chain C residue 119 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links