eF-site ID 2jgc-A
PDB Code 2jgc
Chain A

click to enlarge
Title Structure of the human eIF4E homologous protein, 4EHP without ligand bound
Classification TRANSLATION
Compound EUKARYOTIC TRANSLATION INITIATION FACTOR 4E TYPE 2
Source Homo sapiens (Human) (4EBP1_HUMAN)
Sequence A:  VVPGPAEHPLQYNYTFWYSRRTPGRQNIKQIGTFASVEQF
WRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGK
WIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVR
FQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEY
KTHTDGPQRLLF
Description (1)  EUKARYOTIC TRANSLATION INITIATION FACTOR 4E TYPE 2, EUKARYOTIC TRANSLATION INITIATION FACTOR 4E-BINDING PROTEIN 1


Functional site

1) chain A
residue 71
type BINDING
ligand
sequence R
description 7-methylguanosine-containing mRNA cap.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 112-135
type prosite
ligand
sequence DFHLFKEGIKPMWEDDANKNGGKW
description Eukaryotic initiation factor 4E signature.[DE]-[IFYL]-x(2)-F-[KRL]-x(2)-[LIVM]-x-P-x-W-E-[DVA]-x(5)-G-G-[KR]-W.
source prosite : PS00813


Display surface

Download
Links