eF-site ID 2jgb-AB PDB Code 2jgb Chain A, B click to enlarge Title Structure of human eIF4E homologous protein 4EHP with m7GTP Classification TRANSLATION Compound EUKARYOTIC TRANSLATION INITIATION FACTOR 4E TYPE 2 Source null (4EBP1_HUMAN) Sequence A:  KAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQ IGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMW EDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGE EICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVL NLPPNTIMEYKTHTDSIKMPGPQRLLF B:  RIIYDRKFLMECRNSP Description Functional site 1) chain A residue 67 type sequence R description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 2) chain A residue 73 type sequence T description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 3) chain A residue 78 type sequence Y description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 4) chain A residue 110 type sequence H description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 5) chain A residue 123 type sequence M description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 6) chain A residue 124 type sequence W description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 7) chain A residue 125 type sequence E description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 8) chain A residue 174 type sequence R description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 9) chain A residue 234 type sequence F description BINDING SITE FOR RESIDUE MGT B1000 source : AC1 10) chain B residue 51 type MOD_RES sequence R description Phosphothreonine => ECO:0007744|PubMed:18220336, ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 222 type MOD_RES sequence K description Phosphothreonine => ECO:0007744|PubMed:18220336, ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI1 12) chain B residue 55 type MOD_RES sequence D description Phosphotyrosine => ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 124 type MOD_RES sequence W description Phosphotyrosine => ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 174 type MOD_RES sequence R description Phosphotyrosine => ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI2 15) chain B residue 66 type MOD_RES sequence P description Phosphoserine; by DYRK2, MAPK1, MAPK3 and MTOR => ECO:0000269|PubMed:12588975, ECO:0000269|PubMed:12747827, ECO:0000269|PubMed:22578813, ECO:0000269|PubMed:25702871, ECO:0000269|PubMed:29750193, ECO:0007744|PubMed:17081983, ECO:0007744|PubMed:18669648, ECO:0007744|PubMed:23186163, ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI3 16) chain B residue 58 type CROSSLNK sequence F description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000305|PubMed:22578813 source Swiss-Prot : SWS_FT_FI4 17) chain A residue 112-135 type prosite sequence DFHLFKEGIKPMWEDDANKNGGKW description IF4E Eukaryotic initiation factor 4E signature. DFhlFKegIkPmWEDdanknGGKW source prosite : PS00813 18) chain A residue 222 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ISG15) => ECO:0000269|PubMed:17289916 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links