eF-site ID 2jer-H
PDB Code 2jer
Chain H

click to enlarge
Title Agmatine deiminase of Enterococcus faecalis catalyzing its reaction.
Classification HYDROLASE
Compound AGMATINE DEIMINASE
Source (2JER)
Sequence H:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKRV
Description (1)  AGMATINE DEIMINASE (E.C.3.5.3.12)

Display surface

Download
Links