eF-site ID 2jer-ABCDEFGH
PDB Code 2jer
Chain A, B, C, D, E, F, G, H

click to enlarge
Title Agmatine deiminase of Enterococcus faecalis catalyzing its reaction.
Classification HYDROLASE
Compound AGMATINE DEIMINASE
Source (2JER)
Sequence A:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKRVG
B:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKR
C:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKRVGG
D:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKRVGGKQNSS
E:  MAKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRD
GGKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPP
EITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWG
GLVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGS
FHVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNV
EKVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQN
SPFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIK
GSFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYG
DENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQ
QEPKRVGG
F:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKRVGG
G:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKRVG
H:  AKRIVGSTPKQDGFRMPGEFEPQEKVWMIWPERPDNWRDG
GKPVQEAFTNVAKAISQFTPMNVVVSQQQFQNCRRQLPPE
ITVYEMSNNDAWVRDCGPSFVINDHGEIRGVDWTFNAWGG
LVDGLYFPWDQDDLVAQKICEIEHVDSYRTDDFVLEGGSF
HVDGQGTVLTTEMCLLSEGRNPQLSKEAIEQKLCDYLNVE
KVLWLGDGIDPEETNGHVDDVACFIAPGEVACIYTEDQNS
PFYEAAQDAYQRLLKMTDAKGRQLKVHKLCCPVKNVTIKG
SFKIDFVEGTMPREDGDICIASYMNFLITNDGVIVPQYGD
ENDRLALEQVQTMFPDKKIVGVNTVEVVYGGGNIHXITQQ
EPKRV
Description (1)  AGMATINE DEIMINASE (E.C.3.5.3.12)

Display surface

Download
Links