eF-site ID 2jel-HLP
PDB Code 2jel
Chain H, L, P

click to enlarge
Title JEL42 FAB/HPR COMPLEX
Classification COMPLEX (ANTIBODY/ANTIGEN)
Compound JEL42 FAB FRAGMENT
Source ORGANISM_COMMON: house mouse; ORGANISM_SCIENTIFIC: Mus musculus;
Sequence H:  QVQLAQSGPELVRPGVSVKISCKGSGYTFTTYAMHWVKQS
HAKSLEWIGLISTYSGYTNYNQKFKGKATMTVDKSSSTAY
MELARLTSEDSAIYYCARVMGEQYFDVWGAGTTVIVSSAA
TTPPSVYPLAPGSGGQGNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLAADLYTLSSSVTVPSSPRPSETVTC
NVAHPASSTKVDKKIAPG
L:  DVLMTQTPLSLPVSLGDQASISCRSSQSIVHGNGNTYLEW
YLQKPGQSPKLLIYKISNRFSGVPDRFSGSGSGTDFTLKI
SRVEAEDLGVYYCFQGSHVPYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIGDGAR
QNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCE
ATHKTSDSPIVKSFNRN
P:  MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGK
SASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKL
MAELE
Description (1)  JEL42 FAB FRAGMENT, HISTIDINE-CONTAINING PROTEIN


Functional site

1) chain L
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 L 801
source : AC1

2) chain L
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SO4 L 801
source : AC1

3) chain L
residue 94
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SO4 L 801
source : AC1

4) chain P
residue 3
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE SO4 L 801
source : AC1

5) chain P
residue 17
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 P 802
source : AC2

6) chain P
residue 85
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 P 802
source : AC2

7) chain P
residue 15
type ACT_SITE
ligand
sequence H
description Pros-phosphohistidine intermediate. {ECO:0000255|PROSITE-ProRule:PRU00681, ECO:0000269|PubMed:2261470}.
source Swiss-Prot : SWS_FT_FI1

8) chain P
residue 39-54
type prosite
ligand
sequence GKSASAKSLFKLQTLG
description PTS HPR domain serine phosphorylation site signature. [GSTADE]-[KREQSTIV]-x-{EPRK}-{VPGL}-x-[KRDN]-S-[LIVMF](2)-{EVPL}-[LIVM]
source prosite : PS00589

9) chain P
residue 13-20
type prosite
ligand
sequence GLHTRPAA
description PTS HPR domain histidine phosphorylation site signature. G-[LIVM]-H-[STAV]-R-[PAS]-[GSTA]-[STAMVN]
source prosite : PS00369


Display surface

Download
Links