eF-site ID 2j91-A PDB Code 2j91 Chain A click to enlarge Title Crystal structure of Human Adenylosuccinate Lyase in complex with AMP Classification LYASE Compound ADENYLOSUCCINATE LYASE Source Homo sapiens (Human) (PUR8_HUMAN) Sequence A:  GDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWL WLAEAEQTLGLPITDEQIREMKSNLENIDFKMAAEEEKRL RHDVMAHVHTFGHCCPKAAGIIHLGATSCYVGDNTDLIIL RNALDLLLPKLARVISRLADFAKERASLPTLGFTHFQPAQ LTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKGTTGT QASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYT RKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFYK RNPMRSERCCSLARHLMTLVMDPLQTASVQWFERTLDDSA NRRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQ ELPFMATENIIMAMVGGSRQDCHEKIRVLSQQAASVVKQE GGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQV QRFLEEEVYPLLKPYES Description Functional site 1) chain A residue 111 type sequence T description BINDING SITE FOR RESIDUE CL A1001 source : AC1 2) chain A residue 114 type sequence Y description BINDING SITE FOR RESIDUE CL A1001 source : AC1 3) chain A residue 196 type sequence R description BINDING SITE FOR RESIDUE CL A1001 source : AC1 4) chain A residue 199 type sequence K description BINDING SITE FOR RESIDUE CL A1001 source : AC1 5) chain A residue 200 type sequence G description BINDING SITE FOR RESIDUE CL A1001 source : AC1 6) chain A residue 20 type sequence R description BINDING SITE FOR RESIDUE AMP A1000 source : AC5 7) chain A residue 21 type sequence Y description BINDING SITE FOR RESIDUE AMP A1000 source : AC5 8) chain A residue 299 type sequence M description BINDING SITE FOR RESIDUE AMP A1000 source : AC5 9) chain A residue 303 type sequence R description BINDING SITE FOR RESIDUE AMP A1000 source : AC5 10) chain A residue 159 type sequence H description BINDING SITE FOR RESIDUE AMP C1000 source : AC7 11) chain A residue 85 type sequence R description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 12) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 13) chain A residue 87 type sequence D description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 14) chain A residue 112 type sequence S description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 15) chain A residue 241 type sequence Q description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 16) chain A residue 329 type sequence R description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 17) chain A residue 331 type sequence L description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 18) chain A residue 334 type sequence S description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 19) chain A residue 335 type sequence A description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 20) chain A residue 338 type sequence R description BINDING SITE FOR RESIDUE AMP D1000 source : AC8 21) chain A residue 35 type sequence K description BINDING SITE FOR RESIDUE GOL A1475 source : AC9 22) chain A residue 39 type sequence W description BINDING SITE FOR RESIDUE GOL A1475 source : AC9 23) chain A residue 87 type sequence D description BINDING SITE FOR RESIDUE GOL A1475 source : AC9 24) chain A residue 116 type sequence G description BINDING SITE FOR RESIDUE GOL A1475 source : AC9 25) chain A residue 120 type sequence D description BINDING SITE FOR RESIDUE GOL A1475 source : AC9 26) chain A residue 334 type sequence S description BINDING SITE FOR RESIDUE GOL A1475 source : AC9 27) chain A residue 338 type sequence R description BINDING SITE FOR RESIDUE GOL A1475 source : AC9 28) chain A residue 159 type ACT_SITE sequence H description Proton donor/acceptor => ECO:0000269|PubMed:22812634 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 147 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI5 30) chain A residue 295 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI5 31) chain A residue 415 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) => ECO:0007744|PubMed:25114211 source Swiss-Prot : SWS_FT_FI6 32) chain A residue 20 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 33) chain A residue 303 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 34) chain A residue 85 type BINDING sequence R description in other chain source Swiss-Prot : SWS_FT_FI3 35) chain A residue 111 type BINDING sequence T description in other chain source Swiss-Prot : SWS_FT_FI3 36) chain A residue 241 type BINDING sequence Q description in other chain source Swiss-Prot : SWS_FT_FI3 37) chain A residue 329 type BINDING sequence R description in other chain source Swiss-Prot : SWS_FT_FI3 38) chain A residue 334 type BINDING sequence S description in other chain source Swiss-Prot : SWS_FT_FI3 39) chain A residue 338 type BINDING sequence R description in other chain source Swiss-Prot : SWS_FT_FI3

Display surface Download Links