eF-site ID 2ivz-C
PDB Code 2ivz
Chain C

click to enlarge
Title Structure of TolB in complex with a peptide of the colicin E9 T- domain
Classification PROTEIN TRANSPORT/HYDROLASE
Compound PROTEIN TOLB
Source Escherichia coli (CEA9_ECOLI)
Sequence C:  GRPIGVVPFQWAPEDIGGIVAADLRNSGKFNPLDRARLPQ
QPGSAQEVQPAAWSALGIDAVVVGQVTPNPDGSYNVAYQL
VDTGGAPGTVLAQNSYKVNKQWLRYAGHTASDEVFEKLTG
IKGAFRTRIAYVVQTNGGQFPYELRVSDYDGYNQFVVHRS
PQPLMSPAWSPDGSKLAYVTFESGRSALVIQTLANGAVRQ
VASFPRHNGAPAFSPDGSKLAFALSKTGSLNLYVMDLASG
QIRQVTDGRSNNTEPTWFPDSQNLAFTSDQAGRPQVYKVN
INGGAPQRITWEGSQNQDADVSSDGKFMVMVSSNGQQHIA
KQDLATGGVQVLSSTFLDETPSLAPNGTMVIYSSSQGMGS
VLNLVSTDGRFKARLPATDGQVKFPAWSPYL
Description (1)  PROTEIN TOLB, COLICIN-E9 (E.C.3.1.-.-)


Functional site

1) chain C
residue 337
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C1432
source : AC4

2) chain C
residue 339
type
ligand
sequence D
description BINDING SITE FOR RESIDUE CA C1433
source : AC5

3) chain C
residue 340
type
ligand
sequence V
description BINDING SITE FOR RESIDUE CA C1433
source : AC5


Display surface

Download
Links