eF-site ID 2ipj-A
PDB Code 2ipj
Chain A

click to enlarge
Title Crystal structure of h3alpha-hydroxysteroid dehydrogenase type 3 mutant Y24A in complex with NADP+ and epi-testosterone
Classification OXIDOREDUCTASE
Compound Aldo-keto reductase family 1 member C2
Source Homo sapiens (Human) (AK1C2_HUMAN)
Sequence A:  SKYQCVKLNDGHFMPVLGFGTAAPAEVPKSKALEAVKLAI
EAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYT
SKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSV
KPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKS
IGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKL
LDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLC
ALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQ
VFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDE
Y
Description (1)  Crystal structure of h3alpha-hydroxysteroid dehydrogenase type 3 mutant Y24A in complex with NADP+ and epi-testosterone


Functional site

1) chain A
residue 96
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 B 324
source : AC1

2) chain A
residue 39
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 324
source : AC2

3) chain A
residue 39
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 324
source : AC2

4) chain A
residue 43
type
ligand
sequence E
description BINDING SITE FOR RESIDUE SO4 A 324
source : AC2

5) chain A
residue 68
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 324
source : AC2

6) chain A
residue 22
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

7) chain A
residue 23
type
ligand
sequence T
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

8) chain A
residue 24
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

9) chain A
residue 50
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

10) chain A
residue 55
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

11) chain A
residue 84
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

12) chain A
residue 117
type
ligand
sequence H
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

13) chain A
residue 166
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

14) chain A
residue 167
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

15) chain A
residue 190
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

16) chain A
residue 216
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

17) chain A
residue 217
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

18) chain A
residue 218
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

19) chain A
residue 219
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

20) chain A
residue 220
type
ligand
sequence G
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

21) chain A
residue 221
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

22) chain A
residue 236
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

23) chain A
residue 253
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

24) chain A
residue 268
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

25) chain A
residue 270
type
ligand
sequence K
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

26) chain A
residue 271
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

27) chain A
residue 272
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

28) chain A
residue 276
type
ligand
sequence R
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

29) chain A
residue 279
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

30) chain A
residue 280
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

31) chain A
residue 306
type
ligand
sequence L
description BINDING SITE FOR RESIDUE NAP A 1
source : AC4

32) chain A
residue 54
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FFA A 325
source : AC6

33) chain A
residue 55
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FFA A 325
source : AC6

34) chain A
residue 117
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FFA A 325
source : AC6

35) chain A
residue 227
type
ligand
sequence W
description BINDING SITE FOR RESIDUE FFA A 325
source : AC6

36) chain A
residue 308
type
ligand
sequence L
description BINDING SITE FOR RESIDUE FFA A 325
source : AC6

37) chain A
residue 3
type
ligand
sequence S
description BINDING SITE FOR RESIDUE BME A 326
source : AC8

38) chain A
residue 4
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BME A 326
source : AC8

39) chain A
residue 5
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE BME A 326
source : AC8

40) chain A
residue 7
type
ligand
sequence C
description BINDING SITE FOR RESIDUE BME A 326
source : AC8

41) chain A
residue 4
type
ligand
sequence K
description BINDING SITE FOR RESIDUE BME B 327
source : AC9

42) chain A
residue 242
type
ligand
sequence C
description BINDING SITE FOR RESIDUE BME A 327
source : BC1

43) chain A
residue 252
type
ligand
sequence P
description BINDING SITE FOR RESIDUE BME A 327
source : BC1

44) chain A
residue 203
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EDO A 328
source : BC2

45) chain A
residue 204
type
ligand
sequence D
description BINDING SITE FOR RESIDUE EDO A 328
source : BC2

46) chain A
residue 207
type
ligand
sequence K
description BINDING SITE FOR RESIDUE EDO A 328
source : BC2

47) chain A
residue 263
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO A 328
source : BC2

48) chain A
residue 11
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO A 329
source : BC5

49) chain A
residue 12
type
ligand
sequence D
description BINDING SITE FOR RESIDUE EDO A 329
source : BC5

50) chain A
residue 184
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EDO A 329
source : BC5

51) chain A
residue 185
type
ligand
sequence K
description BINDING SITE FOR RESIDUE EDO A 329
source : BC5

52) chain A
residue 6
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE EDO A 330
source : BC6

53) chain A
residue 17
type
ligand
sequence P
description BINDING SITE FOR RESIDUE EDO A 330
source : BC6

54) chain A
residue 18
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EDO A 330
source : BC6

55) chain A
residue 19
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EDO A 330
source : BC6

56) chain A
residue 45
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO A 330
source : BC6

57) chain A
residue 47
type
ligand
sequence H
description BINDING SITE FOR RESIDUE EDO A 330
source : BC6

58) chain A
residue 284
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO A 330
source : BC6

59) chain A
residue 53
type ACT_SITE
ligand
sequence H
description Proton donor.
source Swiss-Prot : SWS_FT_FI1

60) chain A
residue 48
type BINDING
ligand
sequence H
description NADP. {ECO:0000269|PubMed:11513593, ECO:0000269|PubMed:11514561, ECO:0000269|PubMed:15929998, ECO:0000269|PubMed:17034817, ECO:0000269|PubMed:17442338}.
source Swiss-Prot : SWS_FT_FI2

61) chain A
residue 188
type BINDING
ligand
sequence C
description NADP. {ECO:0000269|PubMed:11513593, ECO:0000269|PubMed:11514561, ECO:0000269|PubMed:15929998, ECO:0000269|PubMed:17034817, ECO:0000269|PubMed:17442338}.
source Swiss-Prot : SWS_FT_FI2

62) chain A
residue 22
type BINDING
ligand
sequence G
description Substrate. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI3

63) chain A
residue 220
type BINDING
ligand
sequence G
description Substrate. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI3

64) chain A
residue 115
type BINDING
ligand
sequence L
description Substrate.
source Swiss-Prot : SWS_FT_FI4

65) chain A
residue 225
type BINDING
ligand
sequence E
description Substrate.
source Swiss-Prot : SWS_FT_FI4

66) chain A
residue 82
type SITE
ligand
sequence T
description Lowers pKa of active site Tyr. {ECO:0000250}.
source Swiss-Prot : SWS_FT_FI5

67) chain A
residue 18-22
type NP_BIND
ligand
sequence VLGFG
description NADP. {ECO:0000269|PubMed:11513593, ECO:0000269|PubMed:11514561, ECO:0000269|PubMed:15929998, ECO:0000269|PubMed:17034817, ECO:0000269|PubMed:17442338}.
source Swiss-Prot : SWS_FT_FI6

68) chain A
residue 164-165
type NP_BIND
ligand
sequence GV
description NADP. {ECO:0000269|PubMed:11513593, ECO:0000269|PubMed:11514561, ECO:0000269|PubMed:15929998, ECO:0000269|PubMed:17034817, ECO:0000269|PubMed:17442338}.
source Swiss-Prot : SWS_FT_FI6

69) chain A
residue 214-220
type NP_BIND
ligand
sequence VAYSALG
description NADP. {ECO:0000269|PubMed:11513593, ECO:0000269|PubMed:11514561, ECO:0000269|PubMed:15929998, ECO:0000269|PubMed:17034817, ECO:0000269|PubMed:17442338}.
source Swiss-Prot : SWS_FT_FI6

70) chain A
residue 268-278
type NP_BIND
ligand
sequence LAKSYNEQRIR
description NADP. {ECO:0000269|PubMed:11513593, ECO:0000269|PubMed:11514561, ECO:0000269|PubMed:15929998, ECO:0000269|PubMed:17034817, ECO:0000269|PubMed:17442338}.
source Swiss-Prot : SWS_FT_FI6

71) chain A
residue 79
type catalytic
ligand
sequence I
description Mapped from 2alr to 2ipj using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 92320300, 94250245, 96022988, 97439701, 98284006
source extCATRES : extCATRES1

72) chain A
residue 49
type catalytic
ligand
sequence I
description Mapped from 2alr to 2ipj using BLAST. All catalytic residues present. Original details record follows: a catalytic site defined by CATRES, Medline 92320300, 94250245, 96022988, 97439701, 98284006
source extCATRES : extCATRES1

73) chain A
residue 151-168
type prosite
ligand
sequence MEKCKDAGLAKSIGVSNF
description Aldo/keto reductase family signature 2. [LIVMFY]-x(8)-{L}-[KREQ]-{K}-[LIVM]-G-[LIVM]-[SC]-N-[FY]
source prosite : PS00062

74) chain A
residue 268-283
type prosite
ligand
sequence LAKSYNEQRIRQNVQV
description Aldo/keto reductase family putative active site signature. [LIVM]-[PAIV]-[KR]-[ST]-{EPQG}-{RFI}-x(2)-R-{SVAF}-x-[GSTAEQK]-[NSL]-x
source prosite : PS00063

75) chain A
residue 3-5
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence SKY
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_A_326

76) chain A
residue 7
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence C
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_A_326

77) chain A
residue 15
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence F
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_A_326

78) chain A
residue 4-5
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence KY
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_B_327

79) chain A
residue 7
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence C
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_B_327

80) chain A
residue 5-6
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence YQ
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_330

81) chain A
residue 17-20
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence PVLG
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_330

82) chain A
residue 45-48
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GFHH
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_330

83) chain A
residue 284
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_330

84) chain A
residue 11-12
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence ND
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_329

85) chain A
residue 155
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence K
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_329

86) chain A
residue 183-185
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence KYK
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_329

87) chain A
residue 21-24
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence FGTA
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

88) chain A
residue 50-51
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence DS
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

89) chain A
residue 55
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence Y
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

90) chain A
residue 84
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence K
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

91) chain A
residue 117
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence H
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

92) chain A
residue 166-167
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence SN
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

93) chain A
residue 190
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence Q
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

94) chain A
residue 216-222
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence YSALGSH
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

95) chain A
residue 236
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence L
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

96) chain A
residue 251
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence T
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

97) chain A
residue 253
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence A
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

98) chain A
residue 268-273
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence LAKSYN
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

99) chain A
residue 276
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence R
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

100) chain A
residue 279-280
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence QN
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

101) chain A
residue 306
type binding
ligand NAP: NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
sequence L
description NADP NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE binding site
source pdb_hetatom : NAP_2ipj_A_1

102) chain A
residue 24
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence A
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

103) chain A
residue 54-55
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence VY
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

104) chain A
residue 86
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence W
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

105) chain A
residue 117
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence H
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

106) chain A
residue 128-129
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence VI
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

107) chain A
residue 167
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence N
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

108) chain A
residue 227
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence W
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

109) chain A
residue 306
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence L
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

110) chain A
residue 308
type binding
ligand FFA: (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE
sequence L
description (10ALPHA,13ALPHA,14BETA,17ALPHA)-17-HYDROXYANDROST-4-EN-3-ONE binding site
source pdb_hetatom : FFA_2ipj_A_325

111) chain A
residue 200
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_328

112) chain A
residue 203-204
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence LD
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_328

113) chain A
residue 207
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence K
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_328

114) chain A
residue 263
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2ipj_A_328

115) chain A
residue 236
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence L
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_A_327

116) chain A
residue 242
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence C
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_A_327

117) chain A
residue 252
type binding
ligand BME: BETA-MERCAPTOETHANOL
sequence P
description BETA-MERCAPTOETHANOL binding site
source pdb_hetatom : BME_2ipj_A_327

118) chain A
residue 84
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1mrq
source CSA : CSA1

119) chain A
residue 117
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1mrq
source CSA : CSA1

120) chain A
residue 50
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1mrq
source CSA : CSA1

121) chain A
residue 55
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1mrq
source CSA : CSA1

122) chain A
residue 84
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1mrq
source CSA : CSA3

123) chain A
residue 55
type catalytic
ligand
sequence Y
description Annotated By Reference To The Literature 1mrq
source CSA : CSA3


Display surface

Download
Links