eF-site ID 2ik6-A PDB Code 2ik6 Chain A click to enlarge Title Yeast inorganic pyrophosphatase variant D120E with magnesium and phosphate Classification HYDROLASE Compound Inorganic pyrophosphatase Source null (IPYR_YEAST) Sequence A:  TYTTRQIGAKNTLEYKVYIEKDGKPVSAFHDIPLYADKEN NIFNMVVEIPRWTNAKLEITKEETLNPIIQDTKKGKLRFV RNCFPHHGYIHNYGAFPQTWEDPGDNDPIEVLEIGETIAY TGQVKQVKALGIMALLDEGETDWKVIAIDINDPLAPKLND IEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAK NKKYALDIIKETHDSWKQLIAGSKGIDLTNVTLPDTPTYS KAASDAIPPASLKADAPIDKSIDKWFFI Description Functional site 1) chain A residue 115 type sequence D description BINDING SITE FOR RESIDUE MG A 287 source : AC1 2) chain A residue 120 type sequence E description BINDING SITE FOR RESIDUE MG A 287 source : AC1 3) chain A residue 152 type sequence D description BINDING SITE FOR RESIDUE MG A 287 source : AC1 4) chain A residue 78 type sequence R description BINDING SITE FOR RESIDUE PO4 A 289 source : AC7 5) chain A residue 147 type sequence D description BINDING SITE FOR RESIDUE PO4 A 289 source : AC7 6) chain A residue 192 type sequence Y description BINDING SITE FOR RESIDUE PO4 A 289 source : AC7 7) chain A residue 193 type sequence K description BINDING SITE FOR RESIDUE PO4 A 289 source : AC7 8) chain A residue 90 type ACT_SITE sequence I description Proton donor => ECO:0000269|PubMed:1322842 source Swiss-Prot : SWS_FT_FI1 9) chain A residue 266 type MOD_RES sequence L description Phosphoserine => ECO:0007744|PubMed:18407956, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI5 10) chain A residue 239 type CROSSLNK sequence G description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI7 11) chain A residue 279 type CROSSLNK sequence W description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0007744|PubMed:22106047 source Swiss-Prot : SWS_FT_FI7 12) chain A residue 79 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI2 13) chain A residue 116 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 14) chain A residue 121 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 153 type BINDING sequence W description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 65 type MOD_RES sequence L description Phosphothreonine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI3 17) chain A residue 251 type MOD_RES sequence P description Phosphothreonine => ECO:0007744|PubMed:15665377, ECO:0007744|PubMed:17330950 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links