eF-site ID 2ia5-K PDB Code 2ia5 Chain K click to enlarge Title T4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. Classification TRANSFERASE Compound Polynucleotide kinase Source null (KIPN_BPT4) Sequence K:  MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQS IMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG VIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELV KRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPK AVIFDVDGTLAKMNKCDTDVINPMVVELSKMYALMGYQIV VVSGRESPTKYYRMTRKWVEDIAGVPLVMQCQREQGDTRK DDVVKEEIFWKHIAPHFDVKLAIDDRTQVVEMWRRIGVEC WQVASGDF Description Functional site 1) chain K residue 10 type sequence C description BINDING SITE FOR RESIDUE SO4 K 941 source : EC2 2) chain K residue 12 type sequence G description BINDING SITE FOR RESIDUE SO4 K 941 source : EC2 3) chain K residue 13 type sequence S description BINDING SITE FOR RESIDUE SO4 K 941 source : EC2 4) chain K residue 14 type sequence G description BINDING SITE FOR RESIDUE SO4 K 941 source : EC2 5) chain K residue 15 type sequence K description BINDING SITE FOR RESIDUE SO4 K 941 source : EC2 6) chain K residue 16 type sequence S description BINDING SITE FOR RESIDUE SO4 K 941 source : EC2 7) chain K residue 126 type sequence R description BINDING SITE FOR RESIDUE SO4 K 941 source : EC2 8) chain K residue 34 type sequence R description BINDING SITE FOR RESIDUE SO4 K 942 source : EC3 9) chain K residue 38 type sequence R description BINDING SITE FOR RESIDUE SO4 K 942 source : EC3 10) chain K residue 85 type sequence D description BINDING SITE FOR RESIDUE SO4 K 942 source : EC3 11) chain K residue 86 type sequence T description BINDING SITE FOR RESIDUE SO4 K 942 source : EC3 12) chain K residue 252 type sequence R description BINDING SITE FOR RESIDUE SO4 K 943 source : EC4 13) chain K residue 253 type sequence K description BINDING SITE FOR RESIDUE SO4 K 943 source : EC4 14) chain K residue 254 type sequence D description BINDING SITE FOR RESIDUE SO4 K 943 source : EC4 15) chain K residue 279 type sequence R description BINDING SITE FOR RESIDUE SO4 K 943 source : EC4 16) chain K residue 281 type sequence Q description BINDING SITE FOR RESIDUE SO4 K 943 source : EC4 17) chain K residue 184 type sequence C description BINDING SITE FOR RESIDUE ARS K 961 source : FC7 18) chain K residue 231 type sequence W description BINDING SITE FOR RESIDUE ARS K 961 source : FC7 19) chain K residue 15 type catalytic sequence K description 625 source MCSA : MCSA11 20) chain K residue 35 type catalytic sequence D description 625 source MCSA : MCSA11 21) chain K residue 126 type catalytic sequence R description 625 source MCSA : MCSA11 22) chain K residue 165 type catalytic sequence D description 625 source MCSA : MCSA11

Display surface Download Links