eF-site ID 2ia5-C
PDB Code 2ia5
Chain C

click to enlarge
Title T4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.
Classification TRANSFERASE
Compound Polynucleotide kinase
Source Enterobacteria phage T4 (Bacteriophage T4) (KIPN_BPT4)
Sequence C:  MKKIILTIGCPGSGKSTWAREFIAKNPGFYNINRDDYRQS
IMAHEERDEYKYTKKKEGIVTGMQFDTAKSILYGGDSVKG
VIISDTNLNPERRLAWETFAKEYGWKVEHKVFDVPWTELV
KRNSKRGTKAVPIDVLRSMYKSMREYLGLPVYNGTPGKPK
AVIFDVDGTLAKMNGPYDLEKCDTDVINPMVVELSKMYAL
MGYQIVVVSGRESGTKEDPTKYYRMTRKWVEDIAGVPLVM
QCQREQGDTRKDDVVKEEIFWKHIAPHFDVKLAIDDRTQV
VEMWRRIGVECWQVASGDF
Description (1)  Polynucleotide kinase (E.C.2.7.1.78)


Functional site

1) chain C
residue 165
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG C 903
source : AC3

2) chain C
residue 167
type
ligand
sequence D
description BINDING SITE FOR RESIDUE MG C 903
source : AC3

3) chain C
residue 12
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 C 917
source : BC5

4) chain C
residue 13
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 C 917
source : BC5

5) chain C
residue 14
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SO4 C 917
source : BC5

6) chain C
residue 15
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 C 917
source : BC5

7) chain C
residue 16
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 C 917
source : BC5

8) chain C
residue 126
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 917
source : BC5

9) chain C
residue 34
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 918
source : BC6

10) chain C
residue 38
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 918
source : BC6

11) chain C
residue 85
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 C 918
source : BC6

12) chain C
residue 86
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SO4 C 918
source : BC6

13) chain C
residue 139
type
ligand
sequence M
description BINDING SITE FOR RESIDUE SO4 C 918
source : BC6

14) chain C
residue 253
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 C 919
source : BC7

15) chain C
residue 254
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SO4 C 919
source : BC7

16) chain C
residue 279
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 C 919
source : BC7

17) chain C
residue 184
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ARS C 953
source : FC1

18) chain C
residue 15
type catalytic
ligand
sequence K
description Annotated By Reference To The Literature 1ltq
source CSA : CSA3

19) chain C
residue 126
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1ltq
source CSA : CSA3

20) chain C
residue 35
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ltq
source CSA : CSA3

21) chain C
residue 165
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1ltq
source CSA : CSA3


Display surface

Download
Links