eF-site ID 2i8e-A PDB Code 2i8e Chain A click to enlarge Title Structure of SSO1404, a predicted DNA repair-associated protein from Sulfolobus solfataricus P2 Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION Compound Hypothetical protein Source null (Q97YC2_SULSO) Sequence A:  AXLYLIFYDITDDNLRNRVAEFLKKKGLDRIQYSVFXGDL NSSRLKDVEAGLKIIGNRKKLQEDERFFILIVPITENQFR ERIVIGYS Description Functional site 1) chain A residue 19 type sequence R description BINDING SITE FOR RESIDUE IOD A 102 source : AC1 2) chain A residue 44 type sequence S description BINDING SITE FOR RESIDUE IOD A 103 source : AC2 3) chain A residue 83 type sequence R description BINDING SITE FOR RESIDUE IOD A 103 source : AC2 4) chain A residue 61 type sequence K description BINDING SITE FOR RESIDUE IOD A 104 source : AC3 5) chain A residue 27 type sequence K description BINDING SITE FOR RESIDUE IOD A 105 source : AC4 6) chain A residue 34 type sequence Y description BINDING SITE FOR RESIDUE IOD A 105 source : AC4 7) chain A residue 45 type sequence R description BINDING SITE FOR RESIDUE IOD A 105 source : AC4 8) chain A residue 10 type BINDING sequence D description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links