eF-site ID 2i68-A PDB Code 2i68 Chain A click to enlarge Title Cryo-EM based theoretical model structure of transmembrane domain of the multidrug-resistance antiporter from E. coli EmrE Classification TRANSPORT PROTEIN Compound Protein emrE Source Escherichia coli (strain K12) (EMRE_ECOLI) Sequence A:  YIYLGGAILAEVIGTTLMVGTIICYCASFWLLAQTLAIAY AIWSGVGIVLISLLSWGFFGAIIGMMLICAGVLIINLL Description Functional site 1) chain A residue 4-21 type TRANSMEM sequence YIYLGGAILAEVIGTTLM description Helical; Name=1 => ECO:0000305|PubMed:17005200 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 34-52 type TRANSMEM sequence VGTIICYCASFWLLAQTLA description Helical; Name=2 => ECO:0000305|PubMed:17005200 source Swiss-Prot : SWS_FT_FI2 3) chain A residue 58-80 type TRANSMEM sequence IAYAIWSGVGIVLISLLSWGFFG description Helical; Name=3 => ECO:0000305|PubMed:17005200 source Swiss-Prot : SWS_FT_FI3 4) chain A residue 87-104 type TRANSMEM sequence AIIGMMLICAGVLIINLL description Helical; Name=4 => ECO:0000305|PubMed:17005200 source Swiss-Prot : SWS_FT_FI4 5) chain A residue 14 type SITE sequence E description Essential for translocation and for substrate and proton binding => ECO:0000305|PubMed:12590142, ECO:0000305|PubMed:29114048 source Swiss-Prot : SWS_FT_FI6 6) chain A residue 4 type SITE sequence Y description Required for proper coupling between the substrate transport and the proton gradient source Swiss-Prot : SWS_FT_FI5 7) chain A residue 60 type SITE sequence Y description Involved in substrate binding source Swiss-Prot : SWS_FT_FI7 8) chain A residue 63 type SITE sequence W description Involved in substrate binding source Swiss-Prot : SWS_FT_FI7 9) chain A residue 40 type SITE sequence Y description Involved in substrate binding source Swiss-Prot : SWS_FT_FI7

Display surface Download Links