eF-site ID 2i42-A PDB Code 2i42 Chain A click to enlarge Title Crystal structure of Yersinia protein tyrosine phosphatase complexed with vanadate, a transition state analogue Classification HYDROLASE Compound Tyrosine-protein phosphatase Source Yersinia enterocolitica (YOPH_YEREN) Sequence A:  SPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACGGEKL NRFRDIQCRRQTAVRADLNANYIQVGNTRTIACQYPLQSQ LESHFRMLAENRTPVLAVLASSSEIANQRFGMPDYFRQSG TYGSITVESKMTQQVGLGDGIMADMYTLTIREAGQKTISV PVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESK GSSAVADDSKLRPVIHCRAGVGRTAQLIGAMCMNDSRNSQ LSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLAEGQGRPLL NS Description Functional site 1) chain A residue 356 type sequence D description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 2) chain A residue 403 type sequence C description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 3) chain A residue 404 type sequence R description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 4) chain A residue 405 type sequence A description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 5) chain A residue 406 type sequence G description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 6) chain A residue 407 type sequence V description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 7) chain A residue 408 type sequence G description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 8) chain A residue 409 type sequence R description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 9) chain A residue 446 type sequence Q description BINDING SITE FOR RESIDUE VO4 A 1 source : AC1 10) chain A residue 290 type catalytic sequence E description 47 source MCSA : MCSA1 11) chain A residue 354 type catalytic sequence W description 47 source MCSA : MCSA1 12) chain A residue 356 type catalytic sequence D description 47 source MCSA : MCSA1 13) chain A residue 402 type catalytic sequence H description 47 source MCSA : MCSA1 14) chain A residue 403 type catalytic sequence C description 47 source MCSA : MCSA1 15) chain A residue 409 type catalytic sequence R description 47 source MCSA : MCSA1 16) chain A residue 410 type catalytic sequence T description 47 source MCSA : MCSA1 17) chain A residue 401-411 type prosite sequence IHCRAGVGRTA description TYR_PHOSPHATASE_1 Tyrosine specific protein phosphatases active site. IHCraGvgRTA source prosite : PS00383 18) chain A residue 403 type ACT_SITE sequence C description Phosphocysteine intermediate source Swiss-Prot : SWS_FT_FI1

Display surface Download Links