eF-site ID 2i3s-C
PDB Code 2i3s
Chain C

click to enlarge
Title Bub3 complex with Bub1 GLEBS motif
Classification CELL CYCLE
Compound Cell cycle arrest protein
Source Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (BUB1_YEAST)
Sequence C:  MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKF
DIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGE
ILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASW
DGLIEVIDPRNYGDGVIAVKNLNSKNKIFTMDTNSSRLIV
GMNNSQVQWFRLPLCEDDNGTIEESGLKYQIRDVALLPKE
QEGYACSSIDGRVAVEFFDDSKRFAFRCHRLNLKDTNLAY
PVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKF
NEDSVVKIACSDNILCLATSDDTFKTNAAIDQTIELNASS
IYIIFDYE
Description (1)  Cell cycle arrest protein BUB3, Checkpoint serine/threonine-protein kinase BUB1 (E.C.2.7.11.1)

Display surface

Download
Links