eF-site ID 2hx3-AB
PDB Code 2hx3
Chain A, B

click to enlarge
Title Rat nNOS heme domain complexed with (4S)-N-{4-Amino-5-[(2-aminoethyl)-hydroxyamino]-pentyl}-N'-nitroguanidine
Classification OXIDOREDUCTASE
Compound Nitric-oxide synthase
Source Rattus norvegicus (Rat) (NOS1_RAT)
Sequence A:  RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP
TKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKEIE
STSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVFDA
RDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTDGK
HDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQQG
WKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIRHP
KFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGWYM
GTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQA
LVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYRCR
GGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQPD
PWNTHVW
B:  RFLKVKNWETDVVLTDTLHLKSTLETGCTEHICMGSIMLP
VRTKDQLFPLAKEFLDQYYSSIKRFGSKAHMDRLEEVNKE
IESTSTYQLKDTELIYGAKHAWRNASRCVGRIQWSKLQVF
DARDCTTAHGMFNYICNHVKYATNKGNLRSAITIFPQRTD
GKHDFRVWNSQLIRYAGYKQPDGSTLGDPANVQFTEICIQ
QGWKAPRGRFDVLPLLLQANGNDPELFQIPPELVLEVPIR
HPKFDWFKDLGLKWYGLPAVSNMLLEIGGLEFSACPFSGW
YMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKD
QALVEINIAVLYSFQSDKVTIVDHHSATESFIKHMENEYR
CRGGCPADWVWIVPPMSGSITPVFHQEMLNYRLTPSFEYQ
PDPWNTHVWKG
Description (1)  Nitric-oxide synthase (E.C.1.14.13.39)


Functional site

1) chain A
residue 417
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ACT A 860
source : AC1

2) chain A
residue 419
type
ligand
sequence I
description BINDING SITE FOR RESIDUE ACT A 860
source : AC1

3) chain A
residue 587
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ACT A 860
source : AC1

4) chain A
residue 657
type
ligand
sequence S
description BINDING SITE FOR RESIDUE ACT A 860
source : AC1

5) chain B
residue 417
type
ligand
sequence G
description BINDING SITE FOR RESIDUE ACT B 860
source : AC2

6) chain B
residue 587
type
ligand
sequence W
description BINDING SITE FOR RESIDUE ACT B 860
source : AC2

7) chain B
residue 649
type
ligand
sequence V
description BINDING SITE FOR RESIDUE ACT B 860
source : AC2

8) chain A
residue 326
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 900
source : AC3

9) chain A
residue 331
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 900
source : AC3

10) chain B
residue 326
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 900
source : AC3

11) chain B
residue 331
type
ligand
sequence C
description BINDING SITE FOR RESIDUE ZN A 900
source : AC3

12) chain A
residue 409
type
ligand
sequence W
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

13) chain A
residue 412
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

14) chain A
residue 415
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

15) chain A
residue 584
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

16) chain A
residue 585
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

17) chain A
residue 586
type
ligand
sequence G
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

18) chain A
residue 587
type
ligand
sequence W
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

19) chain A
residue 592
type
ligand
sequence E
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

20) chain A
residue 678
type
ligand
sequence W
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

21) chain A
residue 704
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

22) chain A
residue 706
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 750
source : AC4

23) chain A
residue 334
type
ligand
sequence S
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

24) chain A
residue 596
type
ligand
sequence R
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

25) chain A
residue 677
type
ligand
sequence V
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

26) chain A
residue 678
type
ligand
sequence W
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

27) chain B
residue 676
type
ligand
sequence W
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

28) chain B
residue 691
type
ligand
sequence F
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

29) chain B
residue 692
type
ligand
sequence H
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

30) chain B
residue 693
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE H4B A 760
source : AC5

31) chain A
residue 478
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 3HX A 793
source : AC6

32) chain A
residue 565
type
ligand
sequence P
description BINDING SITE FOR RESIDUE 3HX A 793
source : AC6

33) chain A
residue 567
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 3HX A 793
source : AC6

34) chain A
residue 585
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 3HX A 793
source : AC6

35) chain A
residue 586
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 3HX A 793
source : AC6

36) chain A
residue 587
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 3HX A 793
source : AC6

37) chain A
residue 592
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 3HX A 793
source : AC6

38) chain B
residue 409
type
ligand
sequence W
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

39) chain B
residue 414
type
ligand
sequence R
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

40) chain B
residue 415
type
ligand
sequence C
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

41) chain B
residue 584
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

42) chain B
residue 585
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

43) chain B
residue 587
type
ligand
sequence W
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

44) chain B
residue 589
type
ligand
sequence M
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

45) chain B
residue 592
type
ligand
sequence E
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

46) chain B
residue 706
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM B 750
source : AC7

47) chain A
residue 676
type
ligand
sequence W
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

48) chain A
residue 691
type
ligand
sequence F
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

49) chain A
residue 692
type
ligand
sequence H
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

50) chain A
residue 693
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

51) chain A
residue 694
type
ligand
sequence E
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

52) chain B
residue 334
type
ligand
sequence S
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

53) chain B
residue 596
type
ligand
sequence R
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

54) chain B
residue 677
type
ligand
sequence V
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

55) chain B
residue 678
type
ligand
sequence W
description BINDING SITE FOR RESIDUE H4B B 760
source : AC8

56) chain B
residue 478
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE 3HX B 793
source : AC9

57) chain B
residue 565
type
ligand
sequence P
description BINDING SITE FOR RESIDUE 3HX B 793
source : AC9

58) chain B
residue 567
type
ligand
sequence V
description BINDING SITE FOR RESIDUE 3HX B 793
source : AC9

59) chain B
residue 585
type
ligand
sequence S
description BINDING SITE FOR RESIDUE 3HX B 793
source : AC9

60) chain B
residue 586
type
ligand
sequence G
description BINDING SITE FOR RESIDUE 3HX B 793
source : AC9

61) chain B
residue 587
type
ligand
sequence W
description BINDING SITE FOR RESIDUE 3HX B 793
source : AC9

62) chain B
residue 592
type
ligand
sequence E
description BINDING SITE FOR RESIDUE 3HX B 793
source : AC9

63) chain A
residue 414-421
type prosite
ligand
sequence RCVGRIQW
description Nitric oxide synthase (NOS) signature. [GR]-C-[IV]-G-R-[ILS]-x-W
source prosite : PS60001

64) chain B
residue 414-421
type prosite
ligand
sequence RCVGRIQW
description Nitric oxide synthase (NOS) signature. [GR]-C-[IV]-G-R-[ILS]-x-W
source prosite : PS60001

65) chain A
residue 306
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence W
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_B_760

66) chain A
residue 676
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence W
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_B_760

67) chain A
residue 691-694
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence FHQE
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_B_760

68) chain B
residue 334-336
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence SIM
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_B_760

69) chain B
residue 596
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence R
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_B_760

70) chain B
residue 677-678
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence VW
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_B_760

71) chain A
residue 334-336
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence SIM
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_A_760

72) chain A
residue 596
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence R
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_A_760

73) chain A
residue 677-680
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence VWIV
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_A_760

74) chain B
residue 306
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence W
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_A_760

75) chain B
residue 676
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence W
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_A_760

76) chain B
residue 691-694
type binding
ligand H4B: 5,6,7,8-TETRAHYDROBIOPTERIN
sequence FHQE
description 5,6,7,8-TETRAHYDROBIOPTERIN binding site
source pdb_hetatom : H4B_2hx3_A_760

77) chain A
residue 409
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence W
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

78) chain A
residue 412
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence A
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

79) chain A
residue 414-417
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence RCVG
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

80) chain A
residue 420
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence Q
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

81) chain A
residue 424
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

82) chain A
residue 457
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence S
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

83) chain A
residue 570
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

84) chain A
residue 584-589
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence FSGWYM
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

85) chain A
residue 592
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence E
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

86) chain A
residue 596
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

87) chain A
residue 649
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence V
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

88) chain A
residue 678
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence W
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

89) chain A
residue 704
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

90) chain A
residue 706
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence Y
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_A_750

91) chain A
residue 416-420
type binding
ligand ACT: ACETATE ION
sequence VGRIQ
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_A_860

92) chain A
residue 587
type binding
ligand ACT: ACETATE ION
sequence W
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_A_860

93) chain A
residue 649
type binding
ligand ACT: ACETATE ION
sequence V
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_A_860

94) chain A
residue 653-654
type binding
ligand ACT: ACETATE ION
sequence SA
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_A_860

95) chain A
residue 657
type binding
ligand ACT: ACETATE ION
sequence S
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_A_860

96) chain A
residue 478
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence Q
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_A_793

97) chain A
residue 565
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence P
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_A_793

98) chain A
residue 567
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence V
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_A_793

99) chain A
residue 584-589
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence FSGWYM
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_A_793

100) chain A
residue 592
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence E
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_A_793

101) chain A
residue 597
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence D
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_A_793

102) chain A
residue 678
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence W
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_A_793

103) chain B
residue 409
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence W
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

104) chain B
residue 412
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence A
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

105) chain B
residue 414-417
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence RCVG
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

106) chain B
residue 420
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence Q
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

107) chain B
residue 424
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence L
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

108) chain B
residue 457-459
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence SAI
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

109) chain B
residue 570
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence M
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

110) chain B
residue 584-589
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence FSGWYM
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

111) chain B
residue 592
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence E
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

112) chain B
residue 596
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence R
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

113) chain B
residue 649
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence V
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

114) chain B
residue 678
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence W
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

115) chain B
residue 704
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence F
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

116) chain B
residue 706
type binding
ligand HEM: PROTOPORPHYRIN IX CONTAINING FE
sequence Y
description PROTOPORPHYRIN IX CONTAINING FE binding site
source pdb_hetatom : HEM_2hx3_B_750

117) chain B
residue 416-417
type binding
ligand ACT: ACETATE ION
sequence VG
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_B_860

118) chain B
residue 419-420
type binding
ligand ACT: ACETATE ION
sequence IQ
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_B_860

119) chain B
residue 587
type binding
ligand ACT: ACETATE ION
sequence W
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_B_860

120) chain B
residue 649
type binding
ligand ACT: ACETATE ION
sequence V
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_B_860

121) chain B
residue 653-654
type binding
ligand ACT: ACETATE ION
sequence SA
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_B_860

122) chain B
residue 657
type binding
ligand ACT: ACETATE ION
sequence S
description ACETATE ION binding site
source pdb_hetatom : ACT_2hx3_B_860

123) chain B
residue 478
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence Q
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

124) chain B
residue 481
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence R
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

125) chain B
residue 565
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence P
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

126) chain B
residue 567
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence V
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

127) chain B
residue 584-589
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence FSGWYM
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

128) chain B
residue 592
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence E
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

129) chain B
residue 597
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence D
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

130) chain B
residue 678
type binding
ligand 3HX: (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE
sequence W
description (4S)-N-{4-AMINO-5-[(2-AMINOETHYL)(HYDROXYAMINO]-PENTYL}-N'-NITROGUANIDINE binding site
source pdb_hetatom : 3HX_2hx3_B_793

131) chain A
residue 415
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 3nos
source CSA : CSA1

132) chain A
residue 587
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 3nos
source CSA : CSA1

133) chain A
residue 592
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 3nos
source CSA : CSA1

134) chain A
residue 418
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 3nos
source CSA : CSA1

135) chain B
residue 415
type catalytic
ligand
sequence C
description Annotated By Reference To The Literature 3nos
source CSA : CSA2

136) chain B
residue 587
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 3nos
source CSA : CSA2

137) chain B
residue 592
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 3nos
source CSA : CSA2

138) chain B
residue 418
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 3nos
source CSA : CSA2


Display surface

Download
Links