eF-site ID 2hve-A PDB Code 2hve Chain A click to enlarge Title S120G mutant of human nucleoside diphosphate kinase A complexed with ADP Classification SIGNALING PROTEIN,TRANSFERASE Compound Nucleoside diphosphate kinase A Source null (NDKA_HUMAN) Sequence A:  ANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFM QASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGL NVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGGD SVESAEKEIGLWFHPEELVDYTSCAQNWIYE Description Functional site 1) chain A residue 12 type sequence K description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 2) chain A residue 52 type sequence Y description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 3) chain A residue 55 type sequence L description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 4) chain A residue 60 type sequence F description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 5) chain A residue 64 type sequence L description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 6) chain A residue 88 type sequence R description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 7) chain A residue 94 type sequence T description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 8) chain A residue 112 type sequence V description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 9) chain A residue 115 type sequence N description BINDING SITE FOR RESIDUE ADP A 160 source : AC1 10) chain A residue 118 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000269|PubMed:1851158 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 122 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 12) chain A residue 125 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 13) chain A residue 120 type MOD_RES sequence G description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 100 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) source Swiss-Prot : SWS_FT_FI4 15) chain A residue 12 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 60 type BINDING sequence F description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 88 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 94 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 105 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 115 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links