eF-site ID 2hrb-A PDB Code 2hrb Chain A click to enlarge Title Crystal Structure of human Carbonyl Reductase 3, complexed with NADP+ Classification OXIDOREDUCTASE Compound Carbonyl reductase [NADPH] 3 Source Homo sapiens (Human) (DHC3_HUMAN) Sequence A:  SRVALVTGANRGIGLAIARELCRQFSGDVVLTARDVARGQ AAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGL NVLVNNAAVAFKSDDPMPFDIKAEMTLKTNFFATRNMCNE LLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLT EGDLVDLMKKFVEDTKNEVHEREGWPNSPYGVSKLGVTVL SRILARRLDEKRKADRILVNACCPGPVKTDMDGKDSIRTV EEGAETPVYLALLPPDATEPQGQLVHDKVVQNW Description Functional site 1) chain A residue 12 type sequence G description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 2) chain A residue 14 type sequence N description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 3) chain A residue 15 type sequence R description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 4) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 5) chain A residue 17 type sequence I description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 6) chain A residue 38 type sequence R description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 7) chain A residue 42 type sequence R description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 8) chain A residue 62 type sequence L description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 9) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 10) chain A residue 64 type sequence I description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 11) chain A residue 65 type sequence D description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 12) chain A residue 90 type sequence N description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 13) chain A residue 91 type sequence A description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 14) chain A residue 92 type sequence A description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 15) chain A residue 138 type sequence I description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 16) chain A residue 139 type sequence S description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 17) chain A residue 194 type sequence Y description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 18) chain A residue 198 type sequence K description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 19) chain A residue 228 type sequence P description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 20) chain A residue 229 type sequence G description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 21) chain A residue 231 type sequence V description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 22) chain A residue 239 type sequence D description BINDING SITE FOR RESIDUE NAP A 1001 source : AC1 23) chain A residue 92 type sequence A description BINDING SITE FOR RESIDUE GOL A 2001 source : AC2 24) chain A residue 93 type sequence V description BINDING SITE FOR RESIDUE GOL A 2001 source : AC2 25) chain A residue 94 type sequence A description BINDING SITE FOR RESIDUE GOL A 2001 source : AC2 26) chain A residue 194 type sequence Y description BINDING SITE FOR RESIDUE GOL A 2001 source : AC2 27) chain A residue 159 type sequence H description BINDING SITE FOR RESIDUE GOL A 2002 source : AC3 28) chain A residue 206 type sequence R description BINDING SITE FOR RESIDUE GOL A 2002 source : AC3 29) chain A residue 276 type sequence N description BINDING SITE FOR RESIDUE GOL A 2002 source : AC3 30) chain A residue 277 type sequence W description BINDING SITE FOR RESIDUE GOL A 2002 source : AC3 31) chain A residue 38 type sequence R description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 32) chain A residue 39 type sequence D description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 33) chain A residue 40 type sequence V description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 34) chain A residue 41 type sequence A description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 35) chain A residue 78 type sequence R description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 36) chain A residue 82 type sequence G description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 37) chain A residue 127 type sequence P description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 38) chain A residue 128 type sequence I description BINDING SITE FOR RESIDUE GOL A 2003 source : AC4 39) chain A residue 196 type ACT_SITE sequence V description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU10001 source Swiss-Prot : SWS_FT_FI1 40) chain A residue 12 type BINDING sequence G description BINDING => ECO:0000269|Ref.13 source Swiss-Prot : SWS_FT_FI2 41) chain A residue 40 type BINDING sequence V description BINDING => ECO:0000269|Ref.13 source Swiss-Prot : SWS_FT_FI2 42) chain A residue 65 type BINDING sequence D description BINDING => ECO:0000269|Ref.13 source Swiss-Prot : SWS_FT_FI2 43) chain A residue 92 type BINDING sequence A description BINDING => ECO:0000269|Ref.13 source Swiss-Prot : SWS_FT_FI2 44) chain A residue 196 type BINDING sequence V description BINDING => ECO:0000269|Ref.13 source Swiss-Prot : SWS_FT_FI2 45) chain A residue 241 type BINDING sequence I description BINDING => ECO:0000269|Ref.13 source Swiss-Prot : SWS_FT_FI2 46) chain A residue 142 type BINDING sequence Q description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 47) chain A residue 32 type MOD_RES sequence D description Phosphoserine => ECO:0000250|UniProtKB:P48758 source Swiss-Prot : SWS_FT_FI4 48) chain A residue 181-209 type prosite sequence NEVHEREGWPNSPYGVSKLGVTVLSRILA description ADH_SHORT Short-chain dehydrogenases/reductases family signature. NevheregwpNspYGVSKLGVtVLSrILA source prosite : PS00061

Display surface Download Links