eF-site ID 2hoa_17-A
PDB Code 2hoa
Model 17
Chain A

click to enlarge
Title STRUCTURE DETERMINATION OF THE ANTP(C39->S) HOMEODOMAIN FROM NUCLEAR MAGNETIC RESONANCE DATA IN SOLUTION USING A NOVEL STRATEGY FOR THE STRUCTURE CALCULATION WITH THE PROGRAMS DIANA, CALIBA, HABAS AND GLOMSA
Classification DNA BINDING PROTEIN
Compound ANTENNAPEDIA PROTEIN
Source Drosophila melanogaster (Fruit fly) (ANTP_DROME)
Sequence A:  MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALS
LTERQIKIWFQNRRMKWKKENKTKGEPG
Description (1)  ANTENNAPEDIA PROTEIN (HOMEODOMAIN) MUTANT WITH CYS 39 REPLACED BY SER (C39S) (NMR, 20 STRUCTURES)


Functional site

1) chain A
residue 2-61
type DNA_BIND
ligand
sequence KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLT
ERQIKIWFQNRRMKWKKENK
description Homeobox.
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 34-57
type prosite
ligand
sequence IAHALSLTERQIKIWFQNRRMKWK
description 'Homeobox' domain signature. [LIVMFYG]-[ASLVR]-x(2)-[LIVMSTACN]-x-[LIVM]-{Y}-x(2)-{L}-[LIV]
source prosite : PS00027


Display surface

Download
Links