eF-site ID 2hl2-B
PDB Code 2hl2
Chain B

click to enlarge
Title Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with an analog of seryladenylate
Classification LIGASE
Compound Threonyl-tRNA synthetase
Source Pyrococcus abyssi (strain GE5 / Orsay) (SYT_PYRAB)
Sequence B:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV
AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP
FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY
KAFKISCKGHPLAELSRTIVPEE
Description (1)  Threonyl-tRNA synthetase (E.C.6.1.1.3)


Functional site

1) chain B
residue 19
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

2) chain B
residue 20
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

3) chain B
residue 43
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

4) chain B
residue 45
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

5) chain B
residue 81
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

6) chain B
residue 82
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

7) chain B
residue 89
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

8) chain B
residue 94
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

9) chain B
residue 117
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

10) chain B
residue 118
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

11) chain B
residue 120
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

12) chain B
residue 19-20
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence AL
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

13) chain B
residue 43-45
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence ISV
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

14) chain B
residue 80-83
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence PFAH
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

15) chain B
residue 88-89
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence LA
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

16) chain B
residue 91
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence P
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

17) chain B
residue 94
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence A
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

18) chain B
residue 98
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence L
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

19) chain B
residue 116-121
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence PFGYYK
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501


Display surface

Download
Links