eF-site ID 2hl2-AB
PDB Code 2hl2
Chain A, B

click to enlarge
Title Crystal structure of the editing domain of threonyl-tRNA synthetase from Pyrococcus abyssi in complex with an analog of seryladenylate
Classification LIGASE
Compound Threonyl-tRNA synthetase
Source Pyrococcus abyssi (strain GE5 / Orsay) (SYT_PYRAB)
Sequence A:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV
AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP
FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY
KAFKISCKGHPLAELSRTIVPEE
B:  MRVLLIHSDYIEYEVKDKALKNPEPISEDMKRGRMEEVLV
AFISVEKVDEKNPEEVSLKAIEEISKVAEQVKAENVFVYP
FAHLSSELAKPSVAMDILNRVYQGLKERGFNVGKAPFGYY
KAFKISCKGHPLAELSRTIVPEE
Description (1)  Threonyl-tRNA synthetase (E.C.6.1.1.3)


Functional site

1) chain A
residue 19
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

2) chain A
residue 20
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

3) chain A
residue 43
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

4) chain A
residue 45
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

5) chain A
residue 88
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

6) chain A
residue 89
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

7) chain A
residue 94
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

8) chain A
residue 117
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

9) chain A
residue 118
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

10) chain A
residue 121
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SSA A 500
source : AC1

11) chain B
residue 19
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

12) chain B
residue 20
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

13) chain B
residue 43
type
ligand
sequence I
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

14) chain B
residue 45
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

15) chain B
residue 81
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

16) chain B
residue 82
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

17) chain B
residue 89
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

18) chain B
residue 94
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

19) chain B
residue 117
type
ligand
sequence F
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

20) chain B
residue 118
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

21) chain B
residue 120
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SSA B 501
source : AC2

22) chain A
residue 19-20
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence AL
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

23) chain A
residue 43-45
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence ISV
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

24) chain A
residue 80-82
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence PFA
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

25) chain A
residue 88-89
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence LA
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

26) chain A
residue 91
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence P
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

27) chain A
residue 94
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence A
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

28) chain A
residue 98
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence L
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

29) chain A
residue 116-121
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence PFGYYK
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_A_500

30) chain B
residue 19-20
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence AL
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

31) chain B
residue 43-45
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence ISV
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

32) chain B
residue 80-83
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence PFAH
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

33) chain B
residue 88-89
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence LA
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

34) chain B
residue 91
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence P
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

35) chain B
residue 94
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence A
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

36) chain B
residue 98
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence L
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501

37) chain B
residue 116-121
type binding
ligand SSA: 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE
sequence PFGYYK
description 5'-O-(N-(L-SERYL)-SULFAMOYL)ADENOSINE binding site
source pdb_hetatom : SSA_2hl2_B_501


Display surface

Download
Links