eF-site ID 2hhl-A PDB Code 2hhl Chain A click to enlarge Title Crystal structure of the human small CTD phosphatase 3 isoform 1 Classification HYDROLASE Compound CTD small phosphatase-like protein Source (CTDSL_HUMAN) Sequence A:  QVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSF KPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLF ECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRG NYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWF DDMTDTELLDLIPFFEGLSR Description Functional site 1) chain A residue 26 type sequence Y description BINDING SITE FOR RESIDUE KEG A 902 source : AC1 2) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE KEG A 902 source : AC1 3) chain A residue 28 type sequence K description BINDING SITE FOR RESIDUE KEG A 902 source : AC1 4) chain A residue 41 type sequence H description BINDING SITE FOR RESIDUE KEG A 902 source : AC1 5) chain A residue 43 type sequence S description BINDING SITE FOR RESIDUE KEG A 902 source : AC1 6) chain A residue 44 type sequence F description BINDING SITE FOR RESIDUE KEG A 902 source : AC1 7) chain A residue 45 type sequence K description BINDING SITE FOR RESIDUE KEG A 902 source : AC1 8) chain A residue 55 type sequence P description BINDING SITE FOR RESIDUE KEG C 900 source : AC2 9) chain A residue 62 type sequence I description BINDING SITE FOR RESIDUE KEG C 900 source : AC2 10) chain A residue 64 type sequence Q description BINDING SITE FOR RESIDUE KEG C 900 source : AC2 11) chain A residue 34 type ACT_SITE sequence D description 4-aspartylphosphate intermediate => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 36 type ACT_SITE sequence D description Proton donor => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 34 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 14) chain A residue 36 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 15) chain A residue 145 type BINDING sequence N description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI3 16) chain A residue 90 type SITE sequence T description Transition state stabilizer => ECO:0000250 source Swiss-Prot : SWS_FT_FI4 17) chain A residue 128 type SITE sequence K description Transition state stabilizer => ECO:0000250 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links