eF-site ID 2hfp-AB PDB Code 2hfp Chain A, B click to enlarge Title Crystal Structure of PPAR Gamma with N-sulfonyl-2-indole carboxamide ligands Classification TRANSCRIPTION Compound Peroxisome proliferator-activated receptor gamma Source Homo sapiens (Human) (Q2T9G5_HUMAN) Sequence A:  PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKS PFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGC QFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEI IYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFME PKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKP IEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQI VTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY B:  TERHKILHRLLQEGSPS Description Functional site 1) chain A residue 259 type sequence E description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 2) chain A residue 265 type sequence K description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 3) chain A residue 266 type sequence H description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 4) chain A residue 281 type sequence I description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 5) chain A residue 284 type sequence G description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 6) chain A residue 285 type sequence C description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 7) chain A residue 288 type sequence R description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 8) chain A residue 292 type sequence A description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 9) chain A residue 326 type sequence I description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 10) chain A residue 330 type sequence L description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 11) chain A residue 341 type sequence I description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 12) chain A residue 342 type sequence S description BINDING SITE FOR RESIDUE NSI A 478 source : AC1 13) chain A residue 278 type sequence A description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 14) chain A residue 285 type sequence C description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 15) chain A residue 286 type sequence Q description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 16) chain A residue 323 type sequence H description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 17) chain A residue 327 type sequence Y description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 18) chain A residue 360 type sequence F description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 19) chain A residue 363 type sequence F description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 20) chain A residue 367 type sequence K description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 21) chain A residue 449 type sequence H description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 22) chain A residue 452 type sequence L description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 23) chain A residue 453 type sequence L description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 24) chain A residue 469 type sequence L description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 25) chain A residue 473 type sequence Y description BINDING SITE FOR RESIDUE NSI A 479 source : AC2 26) chain B residue 615 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 323 type MOD_RES sequence H description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 449 type MOD_RES sequence H description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 473 type MOD_RES sequence Y description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 224 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:36737649 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links