eF-site ID 2heb-A
PDB Code 2heb
Chain A

click to enlarge
Title CONTRIBUTION OF WATER MOLECULES IN THE INTERIOR OF A PROTEIN TO THE CONFORMATIONAL STABILITY
Classification HYDROLASE
Compound LYSOZYME
Source Homo sapiens (Human) (LYSC_HUMAN)
Sequence A:  KVFERCELARTLKRLGMDGYRGASLANWMCLAKWESGYNT
RATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLS
CSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRD
VRQYVQGCGV
Description (1)  LYSOZYME


Functional site

1) chain A
residue 61
type
ligand
sequence S
description BINDING SITE FOR RESIDUE NA A 601
source : AC1

2) chain A
residue 65
type
ligand
sequence C
description BINDING SITE FOR RESIDUE NA A 601
source : AC1

3) chain A
residue 66
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NA A 601
source : AC1

4) chain A
residue 73
type
ligand
sequence A
description BINDING SITE FOR RESIDUE NA A 601
source : AC1

5) chain A
residue 74
type
ligand
sequence V
description BINDING SITE FOR RESIDUE NA A 601
source : AC1

6) chain A
residue 35
type ACT_SITE
ligand
sequence E
description
source Swiss-Prot : SWS_FT_FI1

7) chain A
residue 53
type ACT_SITE
ligand
sequence D
description
source Swiss-Prot : SWS_FT_FI1

8) chain A
residue 77-95
type prosite
ligand
sequence CHLSCSALLQDNIADAVAC
description Alpha-lactalbumin / lysozyme C signature. C-x(3)-C-x(2)-[LMF]-x(3)-[DEN]-[LI]-x(5)-C
source prosite : PS00128

9) chain A
residue 35
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 132l
source CSA : CSA1

10) chain A
residue 53
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 132l
source CSA : CSA1


Display surface

Download
Links