eF-site ID 2hbh-A PDB Code 2hbh Chain A click to enlarge Title Crystal structure of Vitamin D nuclear receptor ligand binding domain bound to a locked side-chain analog of calcitriol and SRC-1 peptide Classification GENE REGULATION Compound Vitamin D receptor Source Danio rerio (Zebrafish) (Brachydanio rerio) (NCOA1_HUMAN) Sequence A:  HMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRLS MLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLKS SAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAGH TLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRPG VQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQKL ADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV Description Functional site 1) chain A residue 175 type sequence Y description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 2) chain A residue 265 type sequence S description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 3) chain A residue 302 type sequence R description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 4) chain A residue 303 type sequence S description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 5) chain A residue 306 type sequence S description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 6) chain A residue 314 type sequence W description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 7) chain A residue 316 type sequence C description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 8) chain A residue 328 type sequence V description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 9) chain A residue 333 type sequence H description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 10) chain A residue 423 type sequence H description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 11) chain A residue 427 type sequence Y description BINDING SITE FOR RESIDUE XE4 A 500 source : AC1 12) chain A residue 265 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 302 type MOD_RES sequence R description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 306 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 333 type MOD_RES sequence H description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 423 type MOD_RES sequence H description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links