eF-site ID 2haz-A
PDB Code 2haz
Chain A

click to enlarge
Title Crystal structure of the first fibronectin domain of human NCAM1
Classification CELL ADHESION
Compound Neural cell adhesion molecule 1
Source (NCA12_HUMAN)
Sequence A:  SHMDTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPILKYK
AEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAV
RLAALNGKGLGEISAASEFKTQPV
Description (1)  Neural cell adhesion molecule 1


Functional site

1) chain A
residue 497
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NA A 101
source : AC1

2) chain A
residue 511
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NA A 101
source : AC1

3) chain A
residue 542
type
ligand
sequence D
description BINDING SITE FOR RESIDUE NA A 101
source : AC1

4) chain A
residue 545
type
ligand
sequence E
description BINDING SITE FOR RESIDUE NA A 101
source : AC1


Display surface

Download
Links