eF-site ID 2h9u-A PDB Code 2h9u Chain A click to enlarge Title Crystal structure of the archaea specific DNA binding protein Classification DNA BINDING PROTEIN Compound DNA/RNA-binding protein Alba 2 Source null (ALBA2_AERPE) Sequence A:  ACEGAPEVRIGRKPVMNYVLAILTTLMEQGTNQVVVKARG RNINRAVDAVEIVRKRFAKNIEIKDIKIDSQEIEVQTPEG QTRTRRVSSIEICLEKAGESA Description Functional site 1) chain A residue 42 type sequence R description BINDING SITE FOR RESIDUE EDO A 1001 source : AC1 2) chain A residue 45 type sequence N description BINDING SITE FOR RESIDUE EDO A 1001 source : AC1 3) chain A residue 46 type sequence R description BINDING SITE FOR RESIDUE EDO A 1001 source : AC1 4) chain A residue 17 type sequence M description BINDING SITE FOR RESIDUE EDO A 2001 source : AC2 5) chain A residue 20 type sequence V description BINDING SITE FOR RESIDUE EDO A 2001 source : AC2 6) chain A residue 40 type sequence R description BINDING SITE FOR RESIDUE EDO A 2001 source : AC2 7) chain A residue 57 type sequence R description BINDING SITE FOR RESIDUE EDO A 2001 source : AC2 8) chain A residue 26 type sequence T description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 9) chain A residue 29 type sequence E description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 10) chain A residue 74 type sequence I description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 11) chain A residue 76 type sequence V description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 12) chain A residue 84 type sequence R description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 13) chain A residue 85 type sequence T description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 14) chain A residue 15 type sequence P description BINDING SITE FOR RESIDUE EDO A 4001 source : AC4 15) chain A residue 46 type sequence R description BINDING SITE FOR RESIDUE EDO A 4001 source : AC4 16) chain A residue 40 type sequence R description BINDING SITE FOR RESIDUE EDO A 5001 source : AC5 17) chain A residue 57 type sequence R description BINDING SITE FOR RESIDUE EDO A 5001 source : AC5 18) chain A residue 12 type sequence G description BINDING SITE FOR RESIDUE EDO A 6001 source : AC6 19) chain A residue 13 type sequence R description BINDING SITE FOR RESIDUE EDO A 6001 source : AC6 20) chain A residue 57 type sequence R description BINDING SITE FOR RESIDUE EDO A 6001 source : AC6 21) chain A residue 13 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22334696, ECO:0007744|PDB:3U6Y source Swiss-Prot : SWS_FT_FI1 22) chain A residue 40 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22334696, ECO:0007744|PDB:3U6Y source Swiss-Prot : SWS_FT_FI1 23) chain A residue 42 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22334696, ECO:0007744|PDB:3U6Y source Swiss-Prot : SWS_FT_FI1 24) chain A residue 43 type BINDING sequence N description BINDING => ECO:0000269|PubMed:22334696, ECO:0007744|PDB:3U6Y source Swiss-Prot : SWS_FT_FI1 25) chain A residue 46 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22334696, ECO:0007744|PDB:3U6Y source Swiss-Prot : SWS_FT_FI1 26) chain A residue 86 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22334696, ECO:0007744|PDB:3U6Y source Swiss-Prot : SWS_FT_FI1 27) chain A residue 10 type BINDING sequence R description BINDING => ECO:0000269|PubMed:22334696, ECO:0007744|PDB:3U6Y source Swiss-Prot : SWS_FT_FI1

Display surface Download Links