eF-site ID 2h71-A PDB Code 2h71 Chain A click to enlarge Title Crystal Structure of Thioredoxin Mutant D47E in Hexagonal (p61) Space Group Classification ELECTRON TRANSPORT Compound Thioredoxin Source (Q2M889_ECOLI) Sequence A:  DKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPI LDEIAEEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLF KNGEVAATKVGALSKGQLKEFLDANLA Description Functional site 1) chain A residue 60 type sequence I description BINDING SITE FOR RESIDUE MPD A 501 source : AC1 2) chain A residue 22 type sequence A description BINDING SITE FOR RESIDUE MPD A 502 source : AC2 3) chain A residue 51 type sequence G description BINDING SITE FOR RESIDUE MPD A 502 source : AC2 4) chain A residue 53 type sequence L description BINDING SITE FOR RESIDUE MPD A 502 source : AC2 5) chain A residue 54 type sequence T description BINDING SITE FOR RESIDUE MPD A 502 source : AC2 6) chain A residue 32 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 7) chain A residue 35 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 8) chain A residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 9) chain A residue 33 type SITE sequence G description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 10) chain A residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 11) chain A residue 69 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 24-42 type prosite sequence LVDFWAEWCGPCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCKmIapiL source prosite : PS00194

Display surface Download Links