eF-site ID 2h34-A PDB Code 2h34 Chain A click to enlarge Title Apoenzyme crystal structure of the tuberculosis serine/threonine kinase, PknE Classification TRANSFERASE Compound Serine/threonine-protein kinase pknE Source (PKNE_MYCTU) Sequence A:  GPYRLRRLVGRGGXGDVYEAEDTVRERIVALKLXSETLSS DPVFRTRXQREARTAGRLQEPHVVPIHDFGEIDGQLYVDX RLINGVDLAAXLRRQGPLAPPRAVAIVRQIGSALDAAHAA GATHRDVKPENILVSADDFAYLVDFGIGTLYYXAPERFSE YRADIYALTCVLYECLTGSPPYQGDQLSVXGAHINQAIPR PSTVRPGIPVAFDAVIARGXAKNPEDRYVTCGDLSAAAHA ALA Description (1)  Apoenzyme crystal structure of the Tuberculosis serine/threonine kinase, PknE Functional site 1) chain A residue 197 type sequence D description BINDING SITE FOR RESIDUE NA A 301 source : AC2 2) chain A residue 198 type sequence I description BINDING SITE FOR RESIDUE NA A 301 source : AC2 3) chain A residue 22-45 type prosite sequence VGRGGXGDVYEAEDTVRERIVALK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. VGRGGMGDVYeAedtvreri..........VALK source prosite : PS00107 4) chain A residue 139 type ACT_SITE sequence D description Proton acceptor => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 22 type BINDING sequence V description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 45 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00159 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 50 type MOD_RES sequence T description Phosphothreonine; by autocatalysis => ECO:0000269|PubMed:15967413 source Swiss-Prot : SWS_FT_FI4 8) chain A residue 59 type MOD_RES sequence T description Phosphothreonine; by autocatalysis => ECO:0000269|PubMed:15967413 source Swiss-Prot : SWS_FT_FI4 9) chain A residue 178 type MOD_RES sequence T description Phosphothreonine; by autocatalysis => ECO:0000269|PubMed:15967413 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links