eF-site ID 2h1x-C
PDB Code 2h1x
Chain C

click to enlarge
Title Crystal structure of 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
Classification HYDROLASE
Compound 5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein)
Source (Q0P422_BRARE)
Sequence C:  SPLSTHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGI
TNDDGRCPGLITKENFIAGVYKMRFETGKYWDALGETCFY
PYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS
Description (1)  5-hydroxyisourate Hydrolase (formerly known as TRP, Transthyretin Related Protein) (E.C.3.5.2.17)


Functional site

1) chain C
residue 12-27
type prosite
ligand
sequence HVLNIAQGVPGANMTI
description Transthyretin signature 1. [KH]-[IV]-L-[DN]-x(3)-G-x-P-[AG]-x(2)-[LIVM]-x-[IV]
source prosite : PS00768


Display surface

Download
Links