eF-site ID 2h0v-A PDB Code 2h0v Chain A click to enlarge Title Crystal structure of a putative quercetin 2,3-dioxygenase (yxag, bsu39980) from bacillus subtilis at 2.60 A resolution Classification OXIDOREDUCTASE Compound Quercetin 2,3-dioxygenase Source null (QDOI_BACSU) Sequence A:  TLCTHSLPKEKXPYLLRSGEGERYLFGRQVATVXANGRST GDLFEIVLLSGGKGDAFPLHVHKDTHEGILVLDGKLELTL DGERYLLISGDYANIPAGTPHSYRXQSHRTRLVSYTXKGN VAHLYSVIGNPYDHAEHPPYASEEVSNERFAEAAAVADIV FLDEAKPACSAKLAELTELPDGAVPYVLESGEGDRLLTGD QLHRIVAAQKNTDGQFIVVSSEGPKGDRIVDHYHEYHTET FYCLEGQXTXWTDGQEIQLNPGDFLHVPANTVHSYRLDSH YTKXVGVLVPGLFEPFFRTLGDPYEGHIFPCEPQALRFDR ILQNIEALDLKVXKP Description Functional site 1) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE FE A 500 source : AC1 2) chain A residue 64 type sequence H description BINDING SITE FOR RESIDUE FE A 500 source : AC1 3) chain A residue 69 type sequence E description BINDING SITE FOR RESIDUE FE A 500 source : AC1 4) chain A residue 103 type sequence H description BINDING SITE FOR RESIDUE FE A 500 source : AC1 5) chain A residue 234 type sequence H description BINDING SITE FOR RESIDUE FE A 501 source : AC2 6) chain A residue 236 type sequence H description BINDING SITE FOR RESIDUE FE A 501 source : AC2 7) chain A residue 241 type sequence E description BINDING SITE FOR RESIDUE FE A 501 source : AC2 8) chain A residue 275 type sequence H description BINDING SITE FOR RESIDUE FE A 501 source : AC2 9) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE EDO A 502 source : AC5 10) chain A residue 64 type sequence H description BINDING SITE FOR RESIDUE EDO A 502 source : AC5 11) chain A residue 69 type sequence E description BINDING SITE FOR RESIDUE EDO A 502 source : AC5 12) chain A residue 103 type sequence H description BINDING SITE FOR RESIDUE EDO A 502 source : AC5 13) chain A residue 127 type sequence Y description BINDING SITE FOR RESIDUE EDO A 502 source : AC5 14) chain A residue 234 type sequence H description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 15) chain A residue 236 type sequence H description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 16) chain A residue 241 type sequence E description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 17) chain A residue 275 type sequence H description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 18) chain A residue 277 type sequence Y description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 19) chain A residue 297 type sequence P description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 20) chain A residue 298 type sequence F description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 21) chain A residue 299 type sequence F description BINDING SITE FOR RESIDUE TLA A 503 source : AC6 22) chain A residue 307 type sequence E description BINDING SITE FOR RESIDUE TRS B 504 source : AC9 23) chain A residue 309 type sequence H description BINDING SITE FOR RESIDUE TRS B 504 source : AC9 24) chain A residue 30 type sequence R description BINDING SITE FOR RESIDUE TRS A 504 source : BC1 25) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE TRS A 504 source : BC1 26) chain A residue 141 type sequence P description BINDING SITE FOR RESIDUE TRS A 504 source : BC1 27) chain A residue 142 type sequence Y description BINDING SITE FOR RESIDUE TRS A 504 source : BC1 28) chain A residue 27 type sequence L description BINDING SITE FOR RESIDUE EDO A 505 source : BC2 29) chain A residue 29 type sequence G description BINDING SITE FOR RESIDUE EDO A 505 source : BC2 30) chain A residue 130 type sequence I description BINDING SITE FOR RESIDUE EDO A 505 source : BC2 31) chain A residue 132 type sequence N description BINDING SITE FOR RESIDUE EDO A 505 source : BC2 32) chain A residue 145 type sequence E description BINDING SITE FOR RESIDUE EDO A 505 source : BC2 33) chain A residue 151 type sequence R description BINDING SITE FOR RESIDUE EDO A 505 source : BC2 34) chain A residue 91 type sequence S description BINDING SITE FOR RESIDUE EDO B 505 source : BC3 35) chain A residue 247 type sequence E description BINDING SITE FOR RESIDUE EDO A 506 source : BC7 36) chain A residue 283 type sequence Y description BINDING SITE FOR RESIDUE EDO A 506 source : BC7 37) chain A residue 285 type sequence K description BINDING SITE FOR RESIDUE EDO A 506 source : BC7 38) chain A residue 247 type sequence E description BINDING SITE FOR RESIDUE EDO A 507 source : BC9 39) chain A residue 173 type sequence A description BINDING SITE FOR RESIDUE EDO B 510 source : CC1 40) chain A residue 175 type sequence L description BINDING SITE FOR RESIDUE EDO B 510 source : CC1 41) chain A residue 55 type sequence K description BINDING SITE FOR RESIDUE EDO A 508 source : CC2 42) chain A residue 77 type sequence K description BINDING SITE FOR RESIDUE EDO A 508 source : CC2 43) chain A residue 282 type sequence H description BINDING SITE FOR RESIDUE EDO A 509 source : CC3 44) chain A residue 20 type sequence S description BINDING SITE FOR RESIDUE EDO B 511 source : CC4 45) chain A residue 111 type sequence R description BINDING SITE FOR RESIDUE EDO B 511 source : CC4 46) chain A residue 113 type sequence R description BINDING SITE FOR RESIDUE EDO B 511 source : CC4 47) chain A residue 263 type sequence P description BINDING SITE FOR RESIDUE EDO B 511 source : CC4 48) chain A residue 175 type sequence L description BINDING SITE FOR RESIDUE EDO B 512 source : CC5 49) chain A residue 76 type sequence G description BINDING SITE FOR RESIDUE EDO A 510 source : CC6 50) chain A residue 90 type sequence I description BINDING SITE FOR RESIDUE EDO A 510 source : CC6 51) chain A residue 91 type sequence S description BINDING SITE FOR RESIDUE EDO A 510 source : CC6 52) chain A residue 74 type sequence L description BINDING SITE FOR RESIDUE EDO A 511 source : CC8 53) chain A residue 113 type sequence R description BINDING SITE FOR RESIDUE EDO A 511 source : CC8 54) chain A residue 244 type sequence Y description BINDING SITE FOR RESIDUE EDO A 511 source : CC8 55) chain A residue 264 type sequence G description BINDING SITE FOR RESIDUE EDO A 511 source : CC8 56) chain A residue 62 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 57) chain A residue 64 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 58) chain A residue 69 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 59) chain A residue 103 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 60) chain A residue 234 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 61) chain A residue 236 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 62) chain A residue 241 type BINDING sequence E description source Swiss-Prot : SWS_FT_FI1 63) chain A residue 275 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1

Display surface Download Links