eF-site ID 2h0d-A PDB Code 2h0d Chain A click to enlarge Title Structure of a Bmi-1-Ring1B Polycomb group ubiquitin ligase complex Classification METAL BINDING PROTEIN/LIGASE Compound B lymphoma Mo-MLV insertion region Source null (RING2_HUMAN) Sequence A:  TRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIV RYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVP GLFKNEMKRRRDFYAAH Description Functional site 1) chain A residue 18 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 2) chain A residue 21 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 3) chain A residue 39 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 4) chain A residue 42 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 5) chain A residue 34 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 6) chain A residue 36 type sequence H description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 7) chain A residue 53 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 8) chain A residue 56 type sequence C description BINDING SITE FOR RESIDUE ZN A 202 source : AC2 9) chain A residue 34-43 type prosite sequence CLHSFCKTCI description ZF_RING_1 Zinc finger RING-type signature. ClHsFCktCI source prosite : PS00518

Display surface Download Links