eF-site ID 2gvf-A PDB Code 2gvf Chain A click to enlarge Title HCV NS3-4A protease domain complexed with a macrocyclic ketoamide inhibitor, SCH419021 Classification HYDROLASE Compound polyprotein Source (NP_671491) Sequence A:  MGAPITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVST ATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNV DQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRR RGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAV CTRGVAKAVDFIPVENLETTMRS Description (1)  polyprotein Functional site 1) chain A residue 97 type sequence C description BINDING SITE FOR RESIDUE ZN A 901 source : AC1 2) chain A residue 98 type sequence T description BINDING SITE FOR RESIDUE ZN A 901 source : AC1 3) chain A residue 99 type sequence C description BINDING SITE FOR RESIDUE ZN A 901 source : AC1 4) chain A residue 145 type sequence C description BINDING SITE FOR RESIDUE ZN A 901 source : AC1 5) chain A residue 41 type sequence Q description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 6) chain A residue 42 type sequence T description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 7) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 8) chain A residue 132 type sequence I description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 9) chain A residue 136 type sequence K description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 10) chain A residue 137 type sequence G description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 11) chain A residue 138 type sequence S description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 12) chain A residue 139 type sequence S description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 13) chain A residue 155 type sequence R description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 14) chain A residue 156 type sequence A description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 15) chain A residue 157 type sequence A description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 16) chain A residue 159 type sequence C description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 17) chain A residue 168 type sequence D description BINDING SITE FOR RESIDUE NHN A 999 source : AC3 18) chain A residue 57 type ACT_SITE sequence H description Charge relay system; for serine protease NS3 activity => ECO:0000255|PROSITE-ProRule:PRU01166 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 81 type ACT_SITE sequence D description Charge relay system; for serine protease NS3 activity => ECO:0000255|PROSITE-ProRule:PRU01166 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 139 type ACT_SITE sequence S description Charge relay system; for serine protease NS3 activity => ECO:0000255|PROSITE-ProRule:PRU01166 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 149 type BINDING sequence H description BINDING => ECO:0000255|PROSITE-ProRule:PRU01166 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 97 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU01166 source Swiss-Prot : SWS_FT_FI2 23) chain A residue 99 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU01166 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 145 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU01166 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links