eF-site ID 2gmh-B
PDB Code 2gmh
Chain B

click to enlarge
Title Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase in Complexed with Ubiquinone
Classification OXIDOREDUCTASE
Compound Electron transfer flavoprotein-ubiquinone oxidoreductase
Source ORGANISM_COMMON: pig; ORGANISM_SCIENTIFIC: Sus scrofa;
Sequence B:  PRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGAGPA
GLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACL
DPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVP
ILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYA
AAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHA
KVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELW
VIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLL
ALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRI
AYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKG
THTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNL
KNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFR
GMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLL
SSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQR
FCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQ
NINWVVPEGGGGPAYNGM
Description (1)  Electron transfer flavoprotein-ubiquinone oxidoreductase (E.C.1.5.5.1)


Functional site

1) chain B
residue 441
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BHG B 618
source : AC3

2) chain B
residue 504
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

3) chain B
residue 528
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

4) chain B
residue 529
type
ligand
sequence P
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

5) chain B
residue 530
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

6) chain B
residue 532
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

7) chain B
residue 533
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

8) chain B
residue 553
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

9) chain B
residue 554
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

10) chain B
residue 556
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

11) chain B
residue 557
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

12) chain B
residue 559
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

13) chain B
residue 570
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

14) chain B
residue 41
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

15) chain B
residue 42
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

16) chain B
residue 45
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

17) chain B
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

18) chain B
residue 71
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

19) chain B
residue 72
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

20) chain B
residue 79
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

21) chain B
residue 82
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

22) chain B
residue 83
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

23) chain B
residue 84
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

24) chain B
residue 85
type
ligand
sequence C
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

25) chain B
residue 167
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

26) chain B
residue 213
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

27) chain B
residue 214
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

28) chain B
residue 218
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

29) chain B
residue 275
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

30) chain B
residue 277
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

31) chain B
residue 331
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

32) chain B
residue 353
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

33) chain B
residue 354
type
ligand
sequence C
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

34) chain B
residue 364
type
ligand
sequence I
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

35) chain B
residue 365
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

36) chain B
residue 366
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

37) chain B
residue 367
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

38) chain B
residue 572
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

39) chain B
residue 114
type
ligand
sequence F
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

40) chain B
residue 133
type
ligand
sequence M
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

41) chain B
residue 260
type
ligand
sequence H
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

42) chain B
residue 261
type
ligand
sequence T
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

43) chain B
residue 262
type
ligand
sequence V
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

44) chain B
residue 272
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

45) chain B
residue 273
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

46) chain B
residue 274
type
ligand
sequence S
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

47) chain B
residue 364
type
ligand
sequence I
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

48) chain B
residue 434
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

49) chain B
residue 435
type
ligand
sequence M
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

50) chain B
residue 438
type
ligand
sequence T
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

51) chain B
residue 439
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

52) chain B
residue 129
type
ligand
sequence P
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

53) chain B
residue 130
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

54) chain B
residue 268
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

55) chain B
residue 443
type
ligand
sequence W
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

56) chain B
residue 528
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

57) chain B
residue 553
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

58) chain B
residue 556
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

59) chain B
residue 559
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

60) chain B
residue 272
type BINDING
ligand
sequence G
description Ubiquinone; via carbonyl oxygen.
source Swiss-Prot : SWS_FT_FI6

61) chain B
residue 273
type BINDING
ligand
sequence G
description Ubiquinone; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI7

62) chain B
residue 42-47
type NP_BIND
ligand
sequence GAGPAG
description FAD.
source Swiss-Prot : SWS_FT_FI8

63) chain B
residue 41-47
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VGAGPAG
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

64) chain B
residue 70-73
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VEKA
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

65) chain B
residue 79-86
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence HTLSGACL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

66) chain B
residue 143
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence L
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

67) chain B
residue 165-167
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence YAA
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

68) chain B
residue 212-215
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence AEGC
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

69) chain B
residue 218-219
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence HL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

70) chain B
residue 241
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence G
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

71) chain B
residue 275
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence F
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

72) chain B
residue 277
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence Y
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

73) chain B
residue 291
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence V
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

74) chain B
residue 331-333
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence RAL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

75) chain B
residue 352-355
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence IGCS
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

76) chain B
residue 359
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence M
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

77) chain B
residue 364-368
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence IKGTH
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

78) chain B
residue 370
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence A
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

79) chain B
residue 557
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence K
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

80) chain B
residue 572
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence V
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

81) chain B
residue 114
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence F
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

82) chain B
residue 125
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence V
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

83) chain B
residue 131
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence L
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

84) chain B
residue 133
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence M
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

85) chain B
residue 260-262
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence HTV
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

86) chain B
residue 271-274
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence YGGS
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

87) chain B
residue 362
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence P
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

88) chain B
residue 364
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence I
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

89) chain B
residue 421-422
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence IR
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

90) chain B
residue 425
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence C
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

91) chain B
residue 431
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence V
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

92) chain B
residue 434-436
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence GMI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

93) chain B
residue 438-440
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence TGI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

94) chain B
residue 443-444
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence WI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

95) chain B
residue 128-130
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence LPG
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_B_620

96) chain B
residue 443
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence W
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_B_620

97) chain B
residue 446
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_B_620

98) chain B
residue 440-441
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence IF
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_B_618

99) chain B
residue 445
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence F
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_B_618

100) chain B
residue 504
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence L
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

101) chain B
residue 527-530
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence FCPA
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

102) chain B
residue 532-533
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence VY
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

103) chain B
residue 553-559
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence CVHCKTC
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

104) chain B
residue 570
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence W
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613


Display surface

Download
Links