eF-site ID 2gmh-AB PDB Code 2gmh Chain A, B click to enlarge Title Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase in Complexed with Ubiquinone Classification OXIDOREDUCTASE Compound Electron transfer flavoprotein-ubiquinone oxidoreductase Source ORGANISM_COMMON: pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence A:  CKVPRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGA GPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSG ACLDPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRI PVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYP GYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLE LHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLK ELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGE PLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGG KRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPK IKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYE DNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYW IFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISF DLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGP EQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKD PSQNINWVVPEGGGGPAYNGM B:  PRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGAGPA GLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACL DPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVP ILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYA AAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHA KVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELW VIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLL ALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRI AYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKG THTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNL KNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFR GMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLL SSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQR FCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQ NINWVVPEGGGGPAYNGM Description (1)  Electron transfer flavoprotein-ubiquinone oxidoreductase (E.C.1.5.5.1) Functional site 1) chain A residue 424 type ligand sequence S description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 2) chain A residue 441 type ligand sequence F description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 3) chain A residue 445 type ligand sequence F description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 4) chain A residue 448 type ligand sequence M description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 5) chain A residue 450 type ligand sequence P description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 6) chain A residue 451 type ligand sequence W description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 7) chain A residue 128 type ligand sequence L description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 8) chain A residue 129 type ligand sequence P description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 9) chain A residue 130 type ligand sequence G description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 10) chain A residue 269 type ligand sequence H description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 11) chain A residue 428 type ligand sequence I description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 12) chain A residue 443 type ligand sequence W description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 13) chain B residue 441 type ligand sequence F description BINDING SITE FOR RESIDUE BHG B 618 source : AC3 14) chain A residue 232 type ligand sequence N description BINDING SITE FOR RESIDUE NA A 1070 source : AC4 15) chain A residue 504 type ligand sequence L description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 16) chain A residue 528 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 17) chain A residue 553 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 18) chain A residue 554 type ligand sequence V description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 19) chain A residue 556 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 20) chain A residue 557 type ligand sequence K description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 21) chain A residue 559 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 22) chain A residue 570 type ligand sequence W description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 23) chain A residue 41 type ligand sequence V description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 24) chain A residue 42 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 25) chain A residue 44 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 26) chain A residue 45 type ligand sequence P description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 27) chain A residue 46 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 28) chain A residue 71 type ligand sequence E description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 29) chain A residue 72 type ligand sequence K description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 30) chain A residue 79 type ligand sequence H description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 31) chain A residue 82 type ligand sequence S description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 32) chain A residue 83 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 33) chain A residue 84 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 34) chain A residue 85 type ligand sequence C description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 35) chain A residue 166 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 36) chain A residue 167 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 37) chain A residue 212 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 38) chain A residue 213 type ligand sequence E description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 39) chain A residue 214 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 40) chain A residue 218 type ligand sequence H description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 41) chain A residue 219 type ligand sequence L description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 42) chain A residue 331 type ligand sequence R description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 43) chain A residue 353 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 44) chain A residue 354 type ligand sequence C description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 45) chain A residue 364 type ligand sequence I description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 46) chain A residue 365 type ligand sequence K description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 47) chain A residue 366 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 48) chain A residue 367 type ligand sequence T description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 49) chain A residue 114 type ligand sequence F description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 50) chain A residue 133 type ligand sequence M description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 51) chain A residue 260 type ligand sequence H description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 52) chain A residue 262 type ligand sequence V description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 53) chain A residue 271 type ligand sequence Y description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 54) chain A residue 272 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 55) chain A residue 273 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 56) chain A residue 274 type ligand sequence S description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 57) chain A residue 364 type ligand sequence I description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 58) chain A residue 434 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 59) chain A residue 435 type ligand sequence M description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 60) chain A residue 438 type ligand sequence T description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 61) chain A residue 439 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 62) chain B residue 504 type ligand sequence L description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 63) chain B residue 528 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 64) chain B residue 529 type ligand sequence P description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 65) chain B residue 530 type ligand sequence A description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 66) chain B residue 532 type ligand sequence V description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 67) chain B residue 533 type ligand sequence Y description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 68) chain B residue 553 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 69) chain B residue 554 type ligand sequence V description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 70) chain B residue 556 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 71) chain B residue 557 type ligand sequence K description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 72) chain B residue 559 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 73) chain B residue 570 type ligand sequence W description BINDING SITE FOR RESIDUE SF4 B 613 source : AC8 74) chain B residue 41 type ligand sequence V description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 75) chain B residue 42 type ligand sequence G description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 76) chain B residue 45 type ligand sequence P description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 77) chain B residue 46 type ligand sequence A description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 78) chain B residue 71 type ligand sequence E description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 79) chain B residue 72 type ligand sequence K description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 80) chain B residue 79 type ligand sequence H description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 81) chain B residue 82 type ligand sequence S description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 82) chain B residue 83 type ligand sequence G description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 83) chain B residue 84 type ligand sequence A description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 84) chain B residue 85 type ligand sequence C description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 85) chain B residue 167 type ligand sequence A description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 86) chain B residue 213 type ligand sequence E description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 87) chain B residue 214 type ligand sequence G description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 88) chain B residue 218 type ligand sequence H description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 89) chain B residue 275 type ligand sequence F description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 90) chain B residue 277 type ligand sequence Y description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 91) chain B residue 331 type ligand sequence R description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 92) chain B residue 353 type ligand sequence G description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 93) chain B residue 354 type ligand sequence C description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 94) chain B residue 364 type ligand sequence I description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 95) chain B residue 365 type ligand sequence K description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 96) chain B residue 366 type ligand sequence G description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 97) chain B residue 367 type ligand sequence T description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 98) chain B residue 572 type ligand sequence V description BINDING SITE FOR RESIDUE FAD B 614 source : AC9 99) chain B residue 114 type ligand sequence F description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 100) chain B residue 133 type ligand sequence M description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 101) chain B residue 260 type ligand sequence H description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 102) chain B residue 261 type ligand sequence T description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 103) chain B residue 262 type ligand sequence V description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 104) chain B residue 272 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 105) chain B residue 273 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 106) chain B residue 274 type ligand sequence S description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 107) chain B residue 364 type ligand sequence I description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 108) chain B residue 434 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 109) chain B residue 435 type ligand sequence M description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 110) chain B residue 438 type ligand sequence T description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 111) chain B residue 439 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 B 615 source : BC1 112) chain A residue 480 type ligand sequence Q description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 113) chain A residue 497 type ligand sequence E description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 114) chain A residue 574 type ligand sequence E description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 115) chain A residue 577 type ligand sequence G description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 116) chain B residue 129 type ligand sequence P description BINDING SITE FOR RESIDUE EDO B 620 source : BC3 117) chain B residue 130 type ligand sequence G description BINDING SITE FOR RESIDUE EDO B 620 source : BC3 118) chain B residue 268 type ligand sequence R description BINDING SITE FOR RESIDUE EDO B 620 source : BC3 119) chain B residue 443 type ligand sequence W description BINDING SITE FOR RESIDUE EDO B 620 source : BC3 120) chain A residue 489 type ligand sequence V description BINDING SITE FOR RESIDUE EDO A 621 source : BC4 121) chain A residue 490 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 621 source : BC4 122) chain A residue 494 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 621 source : BC4 123) chain A residue 12 type ligand sequence H description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 124) chain A residue 13 type ligand sequence Y description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 125) chain A residue 168 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 126) chain A residue 218 type ligand sequence H description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 127) chain A residue 571 type ligand sequence V description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 128) chain A residue 572 type ligand sequence V description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 129) chain A residue 9 type ligand sequence I description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 130) chain A residue 10 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 131) chain A residue 11 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 132) chain A residue 12 type ligand sequence H description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 133) chain A residue 502 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 134) chain A residue 504 type ligand sequence L description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 135) chain A residue 505 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 136) chain A residue 548 type ligand sequence I description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 137) chain A residue 324 type ligand sequence K description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 138) chain A residue 325 type ligand sequence R description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 139) chain A residue 483 type ligand sequence F description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 140) chain A residue 493 type ligand sequence G description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 141) chain A residue 495 type ligand sequence N description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 142) chain A residue 580 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 143) chain A residue 268 type ligand sequence R description BINDING SITE FOR RESIDUE EDO A 625 source : BC8 144) chain A residue 525 type ligand sequence Q description BINDING SITE FOR RESIDUE EDO A 626 source : BC9 145) chain A residue 280 type ligand sequence N description BINDING SITE FOR RESIDUE EDO A 627 source : CC1 146) chain A residue 282 type ligand sequence G description BINDING SITE FOR RESIDUE EDO A 627 source : CC1 147) chain A residue 32 type ligand sequence F description BINDING SITE FOR RESIDUE EDO A 628 source : CC2 148) chain A residue 33 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 628 source : CC2 149) chain A residue 528 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 150) chain A residue 553 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 151) chain A residue 556 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 152) chain A residue 559 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 153) chain A residue 272 type BINDING ligand sequence G description Ubiquinone; via carbonyl oxygen. source Swiss-Prot : SWS_FT_FI2 154) chain A residue 273 type BINDING ligand sequence G description Ubiquinone; via amide nitrogen. source Swiss-Prot : SWS_FT_FI3 155) chain A residue 42-47 type NP_BIND ligand sequence GAGPAG description FAD. source Swiss-Prot : SWS_FT_FI4 156) chain B residue 528 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI5 157) chain B residue 553 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI5 158) chain B residue 556 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI5 159) chain B residue 559 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI5 160) chain B residue 272 type BINDING ligand sequence G description Ubiquinone; via carbonyl oxygen. source Swiss-Prot : SWS_FT_FI6 161) chain B residue 273 type BINDING ligand sequence G description Ubiquinone; via amide nitrogen. source Swiss-Prot : SWS_FT_FI7 162) chain B residue 42-47 type NP_BIND ligand sequence GAGPAG description FAD. source Swiss-Prot : SWS_FT_FI8 163) chain A residue 9-12 type binding ligand EDO: 1,2-ETHANEDIOL sequence ITTH description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 164) chain A residue 501-502 type binding ligand EDO: 1,2-ETHANEDIOL sequence PA description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 165) chain A residue 504-506 type binding ligand EDO: 1,2-ETHANEDIOL sequence LTL description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 166) chain A residue 548 type binding ligand EDO: 1,2-ETHANEDIOL sequence I description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 167) chain A residue 12-14 type binding ligand EDO: 1,2-ETHANEDIOL sequence HYT description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 168) chain A residue 167-169 type binding ligand EDO: 1,2-ETHANEDIOL sequence AAE description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 169) chain A residue 184 type binding ligand EDO: 1,2-ETHANEDIOL sequence N description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 170) chain A residue 218-219 type binding ligand EDO: 1,2-ETHANEDIOL sequence HL description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 171) chain A residue 571-573 type binding ligand EDO: 1,2-ETHANEDIOL sequence VVP description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 172) chain A residue 31-33 type binding ligand EDO: 1,2-ETHANEDIOL sequence RFA description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_628 173) chain A residue 41-47 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence VGAGPAG description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 174) chain A residue 70-73 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence VEKA description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 175) chain A residue 79-86 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence HTLSGACL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 176) chain A residue 143 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence L description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 177) chain A residue 165-167 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence YAA description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 178) chain A residue 212-215 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence AEGC description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 179) chain A residue 218-219 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence HL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 180) chain A residue 241-243 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence GLK description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 181) chain A residue 275 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence F description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 182) chain A residue 277 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence Y description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 183) chain A residue 291 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence V description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 184) chain A residue 331-333 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence RAL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 185) chain A residue 352-355 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence IGCS description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 186) chain A residue 359 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence M description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 187) chain A residue 364-368 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence IKGTH description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 188) chain A residue 370 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence A description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 189) chain A residue 572 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence V description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 190) chain A residue 114 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence F description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 191) chain A residue 125 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 192) chain A residue 131 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence L description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 193) chain A residue 133 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence M description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 194) chain A residue 260-262 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence HTV description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 195) chain A residue 271-275 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence YGGSF description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 196) chain A residue 291 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 197) chain A residue 362 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence P description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 198) chain A residue 364 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence I description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 199) chain A residue 421 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence I description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 200) chain A residue 425 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence C description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 201) chain A residue 431 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 202) chain A residue 434-436 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence GMI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 203) chain A residue 438-440 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence TGI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 204) chain A residue 443-444 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence WI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 205) chain A residue 128-131 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence LPGL description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_617 206) chain A residue 443-444 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence WI description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_617 207) chain A residue 446 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence R description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_617 208) chain A residue 253 type binding ligand EDO: 1,2-ETHANEDIOL sequence W description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_627 209) chain A residue 280-282 type binding ligand EDO: 1,2-ETHANEDIOL sequence NEG description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_627 210) chain A residue 267-268 type binding ligand EDO: 1,2-ETHANEDIOL sequence DR description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_625 211) chain A residue 432 type binding ligand EDO: 1,2-ETHANEDIOL sequence Y description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_625 212) chain A residue 424 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence S description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 213) chain A residue 427 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence G description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 214) chain A residue 437 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence Y description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 215) chain A residue 441 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence F description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 216) chain A residue 451 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence W description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 217) chain A residue 453 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence L description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 218) chain A residue 486 type binding ligand EDO: 1,2-ETHANEDIOL sequence L description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 219) chain A residue 489-490 type binding ligand EDO: 1,2-ETHANEDIOL sequence VA description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 220) chain A residue 492-495 type binding ligand EDO: 1,2-ETHANEDIOL sequence SGTN description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 221) chain A residue 552 type binding ligand EDO: 1,2-ETHANEDIOL sequence N description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 222) chain A residue 493-495 type binding ligand EDO: 1,2-ETHANEDIOL sequence GTN description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_624 223) chain A residue 580 type binding ligand EDO: 1,2-ETHANEDIOL sequence A description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_624 224) chain A residue 495-497 type binding ligand EDO: 1,2-ETHANEDIOL sequence NHE description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_619 225) chain A residue 500 type binding ligand EDO: 1,2-ETHANEDIOL sequence Q description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_619 226) chain A residue 574-577 type binding ligand EDO: 1,2-ETHANEDIOL sequence EGGG description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_619 227) chain A residue 504 type binding ligand SF4: IRON/SULFUR CLUSTER sequence L description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 228) chain A residue 527-530 type binding ligand SF4: IRON/SULFUR CLUSTER sequence FCPA description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 229) chain A residue 532-533 type binding ligand SF4: IRON/SULFUR CLUSTER sequence VY description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 230) chain A residue 553-559 type binding ligand SF4: IRON/SULFUR CLUSTER sequence CVHCKTC description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 231) chain A residue 570 type binding ligand SF4: IRON/SULFUR CLUSTER sequence W description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 232) chain A residue 517 type binding ligand EDO: 1,2-ETHANEDIOL sequence L description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 233) chain A residue 521 type binding ligand EDO: 1,2-ETHANEDIOL sequence D description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 234) chain A residue 525 type binding ligand EDO: 1,2-ETHANEDIOL sequence Q description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 235) chain A residue 535 type binding ligand EDO: 1,2-ETHANEDIOL sequence F description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 236) chain A residue 544 type binding ligand EDO: 1,2-ETHANEDIOL sequence F description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 237) chain B residue 41-47 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence VGAGPAG description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 238) chain B residue 70-73 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence VEKA description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 239) chain B residue 79-86 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence HTLSGACL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 240) chain B residue 143 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence L description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 241) chain B residue 165-167 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence YAA description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 242) chain B residue 212-215 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence AEGC description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 243) chain B residue 218-219 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence HL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 244) chain B residue 241 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence G description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 245) chain B residue 275 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence F description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 246) chain B residue 277 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence Y description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 247) chain B residue 291 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence V description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 248) chain B residue 331-333 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence RAL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 249) chain B residue 352-355 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence IGCS description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 250) chain B residue 359 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence M description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 251) chain B residue 364-368 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence IKGTH description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 252) chain B residue 370 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence A description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 253) chain B residue 557 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence K description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 254) chain B residue 572 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence V description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_B_614 255) chain B residue 114 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence F description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 256) chain B residue 125 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 257) chain B residue 131 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence L description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 258) chain B residue 133 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence M description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 259) chain B residue 260-262 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence HTV description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 260) chain B residue 271-274 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence YGGS description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 261) chain B residue 362 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence P description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 262) chain B residue 364 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence I description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 263) chain B residue 421-422 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence IR description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 264) chain B residue 425 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence C description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 265) chain B residue 431 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 266) chain B residue 434-436 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence GMI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 267) chain B residue 438-440 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence TGI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 268) chain B residue 443-444 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence WI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_B_615 269) chain B residue 128-130 type binding ligand EDO: 1,2-ETHANEDIOL sequence LPG description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_B_620 270) chain B residue 443 type binding ligand EDO: 1,2-ETHANEDIOL sequence W description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_B_620 271) chain B residue 446 type binding ligand EDO: 1,2-ETHANEDIOL sequence R description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_B_620 272) chain B residue 440-441 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence IF description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_B_618 273) chain B residue 445 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence F description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_B_618 274) chain B residue 504 type binding ligand SF4: IRON/SULFUR CLUSTER sequence L description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_B_613 275) chain B residue 527-530 type binding ligand SF4: IRON/SULFUR CLUSTER sequence FCPA description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_B_613 276) chain B residue 532-533 type binding ligand SF4: IRON/SULFUR CLUSTER sequence VY description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_B_613 277) chain B residue 553-559 type binding ligand SF4: IRON/SULFUR CLUSTER sequence CVHCKTC description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_B_613 278) chain B residue 570 type binding ligand SF4: IRON/SULFUR CLUSTER sequence W description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_B_613

Display surface Download Links