eF-site ID 2gmh-AB
PDB Code 2gmh
Chain A, B

click to enlarge
Title Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase in Complexed with Ubiquinone
Classification OXIDOREDUCTASE
Compound Electron transfer flavoprotein-ubiquinone oxidoreductase
Source ORGANISM_COMMON: pig; ORGANISM_SCIENTIFIC: Sus scrofa;
Sequence A:  CKVPRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGA
GPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSG
ACLDPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRI
PVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYP
GYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLE
LHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLK
ELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGE
PLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGG
KRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPK
IKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYE
DNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYW
IFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISF
DLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGP
EQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKD
PSQNINWVVPEGGGGPAYNGM
B:  PRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGAGPA
GLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSGACL
DPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVP
ILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYPGYA
AAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHA
KVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELW
VIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLL
ALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGGKRI
AYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKG
THTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYEDNL
KNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYWIFR
GMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLL
SSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGPEQR
FCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQ
NINWVVPEGGGGPAYNGM
Description (1)  Electron transfer flavoprotein-ubiquinone oxidoreductase (E.C.1.5.5.1)


Functional site

1) chain A
residue 424
type
ligand
sequence S
description BINDING SITE FOR RESIDUE BHG A 616
source : AC1

2) chain A
residue 441
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BHG A 616
source : AC1

3) chain A
residue 445
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BHG A 616
source : AC1

4) chain A
residue 448
type
ligand
sequence M
description BINDING SITE FOR RESIDUE BHG A 616
source : AC1

5) chain A
residue 450
type
ligand
sequence P
description BINDING SITE FOR RESIDUE BHG A 616
source : AC1

6) chain A
residue 451
type
ligand
sequence W
description BINDING SITE FOR RESIDUE BHG A 616
source : AC1

7) chain A
residue 128
type
ligand
sequence L
description BINDING SITE FOR RESIDUE BHG A 617
source : AC2

8) chain A
residue 129
type
ligand
sequence P
description BINDING SITE FOR RESIDUE BHG A 617
source : AC2

9) chain A
residue 130
type
ligand
sequence G
description BINDING SITE FOR RESIDUE BHG A 617
source : AC2

10) chain A
residue 269
type
ligand
sequence H
description BINDING SITE FOR RESIDUE BHG A 617
source : AC2

11) chain A
residue 428
type
ligand
sequence I
description BINDING SITE FOR RESIDUE BHG A 617
source : AC2

12) chain A
residue 443
type
ligand
sequence W
description BINDING SITE FOR RESIDUE BHG A 617
source : AC2

13) chain B
residue 441
type
ligand
sequence F
description BINDING SITE FOR RESIDUE BHG B 618
source : AC3

14) chain A
residue 232
type
ligand
sequence N
description BINDING SITE FOR RESIDUE NA A 1070
source : AC4

15) chain A
residue 504
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

16) chain A
residue 528
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

17) chain A
residue 553
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

18) chain A
residue 554
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

19) chain A
residue 556
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

20) chain A
residue 557
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

21) chain A
residue 559
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

22) chain A
residue 570
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SF4 A 610
source : AC5

23) chain A
residue 41
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

24) chain A
residue 42
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

25) chain A
residue 44
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

26) chain A
residue 45
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

27) chain A
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

28) chain A
residue 71
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

29) chain A
residue 72
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

30) chain A
residue 79
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

31) chain A
residue 82
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

32) chain A
residue 83
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

33) chain A
residue 84
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

34) chain A
residue 85
type
ligand
sequence C
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

35) chain A
residue 166
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

36) chain A
residue 167
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

37) chain A
residue 212
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

38) chain A
residue 213
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

39) chain A
residue 214
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

40) chain A
residue 218
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

41) chain A
residue 219
type
ligand
sequence L
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

42) chain A
residue 331
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

43) chain A
residue 353
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

44) chain A
residue 354
type
ligand
sequence C
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

45) chain A
residue 364
type
ligand
sequence I
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

46) chain A
residue 365
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

47) chain A
residue 366
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

48) chain A
residue 367
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FAD A 611
source : AC6

49) chain A
residue 114
type
ligand
sequence F
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

50) chain A
residue 133
type
ligand
sequence M
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

51) chain A
residue 260
type
ligand
sequence H
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

52) chain A
residue 262
type
ligand
sequence V
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

53) chain A
residue 271
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

54) chain A
residue 272
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

55) chain A
residue 273
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

56) chain A
residue 274
type
ligand
sequence S
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

57) chain A
residue 364
type
ligand
sequence I
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

58) chain A
residue 434
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

59) chain A
residue 435
type
ligand
sequence M
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

60) chain A
residue 438
type
ligand
sequence T
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

61) chain A
residue 439
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 A 612
source : AC7

62) chain B
residue 504
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

63) chain B
residue 528
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

64) chain B
residue 529
type
ligand
sequence P
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

65) chain B
residue 530
type
ligand
sequence A
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

66) chain B
residue 532
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

67) chain B
residue 533
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

68) chain B
residue 553
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

69) chain B
residue 554
type
ligand
sequence V
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

70) chain B
residue 556
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

71) chain B
residue 557
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

72) chain B
residue 559
type
ligand
sequence C
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

73) chain B
residue 570
type
ligand
sequence W
description BINDING SITE FOR RESIDUE SF4 B 613
source : AC8

74) chain B
residue 41
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

75) chain B
residue 42
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

76) chain B
residue 45
type
ligand
sequence P
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

77) chain B
residue 46
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

78) chain B
residue 71
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

79) chain B
residue 72
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

80) chain B
residue 79
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

81) chain B
residue 82
type
ligand
sequence S
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

82) chain B
residue 83
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

83) chain B
residue 84
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

84) chain B
residue 85
type
ligand
sequence C
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

85) chain B
residue 167
type
ligand
sequence A
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

86) chain B
residue 213
type
ligand
sequence E
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

87) chain B
residue 214
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

88) chain B
residue 218
type
ligand
sequence H
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

89) chain B
residue 275
type
ligand
sequence F
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

90) chain B
residue 277
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

91) chain B
residue 331
type
ligand
sequence R
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

92) chain B
residue 353
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

93) chain B
residue 354
type
ligand
sequence C
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

94) chain B
residue 364
type
ligand
sequence I
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

95) chain B
residue 365
type
ligand
sequence K
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

96) chain B
residue 366
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

97) chain B
residue 367
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

98) chain B
residue 572
type
ligand
sequence V
description BINDING SITE FOR RESIDUE FAD B 614
source : AC9

99) chain B
residue 114
type
ligand
sequence F
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

100) chain B
residue 133
type
ligand
sequence M
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

101) chain B
residue 260
type
ligand
sequence H
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

102) chain B
residue 261
type
ligand
sequence T
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

103) chain B
residue 262
type
ligand
sequence V
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

104) chain B
residue 272
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

105) chain B
residue 273
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

106) chain B
residue 274
type
ligand
sequence S
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

107) chain B
residue 364
type
ligand
sequence I
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

108) chain B
residue 434
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

109) chain B
residue 435
type
ligand
sequence M
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

110) chain B
residue 438
type
ligand
sequence T
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

111) chain B
residue 439
type
ligand
sequence G
description BINDING SITE FOR RESIDUE UQ5 B 615
source : BC1

112) chain A
residue 480
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE EDO A 619
source : BC2

113) chain A
residue 497
type
ligand
sequence E
description BINDING SITE FOR RESIDUE EDO A 619
source : BC2

114) chain A
residue 574
type
ligand
sequence E
description BINDING SITE FOR RESIDUE EDO A 619
source : BC2

115) chain A
residue 577
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO A 619
source : BC2

116) chain B
residue 129
type
ligand
sequence P
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

117) chain B
residue 130
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

118) chain B
residue 268
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

119) chain B
residue 443
type
ligand
sequence W
description BINDING SITE FOR RESIDUE EDO B 620
source : BC3

120) chain A
residue 489
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EDO A 621
source : BC4

121) chain A
residue 490
type
ligand
sequence A
description BINDING SITE FOR RESIDUE EDO A 621
source : BC4

122) chain A
residue 494
type
ligand
sequence T
description BINDING SITE FOR RESIDUE EDO A 621
source : BC4

123) chain A
residue 12
type
ligand
sequence H
description BINDING SITE FOR RESIDUE EDO A 622
source : BC5

124) chain A
residue 13
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE EDO A 622
source : BC5

125) chain A
residue 168
type
ligand
sequence A
description BINDING SITE FOR RESIDUE EDO A 622
source : BC5

126) chain A
residue 218
type
ligand
sequence H
description BINDING SITE FOR RESIDUE EDO A 622
source : BC5

127) chain A
residue 571
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EDO A 622
source : BC5

128) chain A
residue 572
type
ligand
sequence V
description BINDING SITE FOR RESIDUE EDO A 622
source : BC5

129) chain A
residue 9
type
ligand
sequence I
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

130) chain A
residue 10
type
ligand
sequence T
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

131) chain A
residue 11
type
ligand
sequence T
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

132) chain A
residue 12
type
ligand
sequence H
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

133) chain A
residue 502
type
ligand
sequence A
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

134) chain A
residue 504
type
ligand
sequence L
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

135) chain A
residue 505
type
ligand
sequence T
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

136) chain A
residue 548
type
ligand
sequence I
description BINDING SITE FOR RESIDUE EDO A 623
source : BC6

137) chain A
residue 324
type
ligand
sequence K
description BINDING SITE FOR RESIDUE EDO A 624
source : BC7

138) chain A
residue 325
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO A 624
source : BC7

139) chain A
residue 483
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO A 624
source : BC7

140) chain A
residue 493
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO A 624
source : BC7

141) chain A
residue 495
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO A 624
source : BC7

142) chain A
residue 580
type
ligand
sequence A
description BINDING SITE FOR RESIDUE EDO A 624
source : BC7

143) chain A
residue 268
type
ligand
sequence R
description BINDING SITE FOR RESIDUE EDO A 625
source : BC8

144) chain A
residue 525
type
ligand
sequence Q
description BINDING SITE FOR RESIDUE EDO A 626
source : BC9

145) chain A
residue 280
type
ligand
sequence N
description BINDING SITE FOR RESIDUE EDO A 627
source : CC1

146) chain A
residue 282
type
ligand
sequence G
description BINDING SITE FOR RESIDUE EDO A 627
source : CC1

147) chain A
residue 32
type
ligand
sequence F
description BINDING SITE FOR RESIDUE EDO A 628
source : CC2

148) chain A
residue 33
type
ligand
sequence A
description BINDING SITE FOR RESIDUE EDO A 628
source : CC2

149) chain A
residue 528
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI1

150) chain A
residue 553
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI1

151) chain A
residue 556
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI1

152) chain A
residue 559
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI1

153) chain A
residue 272
type BINDING
ligand
sequence G
description Ubiquinone; via carbonyl oxygen.
source Swiss-Prot : SWS_FT_FI2

154) chain A
residue 273
type BINDING
ligand
sequence G
description Ubiquinone; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI3

155) chain A
residue 42-47
type NP_BIND
ligand
sequence GAGPAG
description FAD.
source Swiss-Prot : SWS_FT_FI4

156) chain B
residue 528
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

157) chain B
residue 553
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

158) chain B
residue 556
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

159) chain B
residue 559
type METAL
ligand
sequence C
description Iron-sulfur (4Fe-4S)
source Swiss-Prot : SWS_FT_FI5

160) chain B
residue 272
type BINDING
ligand
sequence G
description Ubiquinone; via carbonyl oxygen.
source Swiss-Prot : SWS_FT_FI6

161) chain B
residue 273
type BINDING
ligand
sequence G
description Ubiquinone; via amide nitrogen.
source Swiss-Prot : SWS_FT_FI7

162) chain B
residue 42-47
type NP_BIND
ligand
sequence GAGPAG
description FAD.
source Swiss-Prot : SWS_FT_FI8

163) chain A
residue 9-12
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence ITTH
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_623

164) chain A
residue 501-502
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence PA
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_623

165) chain A
residue 504-506
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence LTL
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_623

166) chain A
residue 548
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence I
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_623

167) chain A
residue 12-14
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence HYT
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_622

168) chain A
residue 167-169
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence AAE
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_622

169) chain A
residue 184
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_622

170) chain A
residue 218-219
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence HL
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_622

171) chain A
residue 571-573
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence VVP
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_622

172) chain A
residue 31-33
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence RFA
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_628

173) chain A
residue 41-47
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VGAGPAG
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

174) chain A
residue 70-73
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VEKA
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

175) chain A
residue 79-86
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence HTLSGACL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

176) chain A
residue 143
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence L
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

177) chain A
residue 165-167
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence YAA
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

178) chain A
residue 212-215
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence AEGC
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

179) chain A
residue 218-219
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence HL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

180) chain A
residue 241-243
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence GLK
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

181) chain A
residue 275
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence F
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

182) chain A
residue 277
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence Y
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

183) chain A
residue 291
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence V
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

184) chain A
residue 331-333
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence RAL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

185) chain A
residue 352-355
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence IGCS
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

186) chain A
residue 359
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence M
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

187) chain A
residue 364-368
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence IKGTH
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

188) chain A
residue 370
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence A
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

189) chain A
residue 572
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence V
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_A_611

190) chain A
residue 114
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence F
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

191) chain A
residue 125
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence V
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

192) chain A
residue 131
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence L
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

193) chain A
residue 133
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence M
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

194) chain A
residue 260-262
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence HTV
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

195) chain A
residue 271-275
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence YGGSF
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

196) chain A
residue 291
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence V
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

197) chain A
residue 362
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence P
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

198) chain A
residue 364
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence I
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

199) chain A
residue 421
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence I
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

200) chain A
residue 425
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence C
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

201) chain A
residue 431
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence V
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

202) chain A
residue 434-436
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence GMI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

203) chain A
residue 438-440
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence TGI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

204) chain A
residue 443-444
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence WI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_A_612

205) chain A
residue 128-131
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence LPGL
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_617

206) chain A
residue 443-444
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence WI
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_617

207) chain A
residue 446
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence R
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_617

208) chain A
residue 253
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence W
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_627

209) chain A
residue 280-282
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence NEG
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_627

210) chain A
residue 267-268
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence DR
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_625

211) chain A
residue 432
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence Y
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_625

212) chain A
residue 424
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence S
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_616

213) chain A
residue 427
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence G
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_616

214) chain A
residue 437
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence Y
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_616

215) chain A
residue 441
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence F
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_616

216) chain A
residue 451
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence W
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_616

217) chain A
residue 453
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence L
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_A_616

218) chain A
residue 486
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_621

219) chain A
residue 489-490
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence VA
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_621

220) chain A
residue 492-495
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence SGTN
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_621

221) chain A
residue 552
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence N
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_621

222) chain A
residue 493-495
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence GTN
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_624

223) chain A
residue 580
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence A
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_624

224) chain A
residue 495-497
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence NHE
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_619

225) chain A
residue 500
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence Q
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_619

226) chain A
residue 574-577
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence EGGG
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_619

227) chain A
residue 504
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence L
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_A_610

228) chain A
residue 527-530
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence FCPA
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_A_610

229) chain A
residue 532-533
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence VY
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_A_610

230) chain A
residue 553-559
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence CVHCKTC
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_A_610

231) chain A
residue 570
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence W
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_A_610

232) chain A
residue 517
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence L
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_626

233) chain A
residue 521
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence D
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_626

234) chain A
residue 525
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence Q
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_626

235) chain A
residue 535
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_626

236) chain A
residue 544
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence F
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_A_626

237) chain B
residue 41-47
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VGAGPAG
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

238) chain B
residue 70-73
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence VEKA
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

239) chain B
residue 79-86
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence HTLSGACL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

240) chain B
residue 143
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence L
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

241) chain B
residue 165-167
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence YAA
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

242) chain B
residue 212-215
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence AEGC
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

243) chain B
residue 218-219
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence HL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

244) chain B
residue 241
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence G
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

245) chain B
residue 275
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence F
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

246) chain B
residue 277
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence Y
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

247) chain B
residue 291
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence V
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

248) chain B
residue 331-333
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence RAL
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

249) chain B
residue 352-355
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence IGCS
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

250) chain B
residue 359
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence M
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

251) chain B
residue 364-368
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence IKGTH
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

252) chain B
residue 370
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence A
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

253) chain B
residue 557
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence K
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

254) chain B
residue 572
type binding
ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE
sequence V
description FLAVIN-ADENINE DINUCLEOTIDE binding site
source pdb_hetatom : FAD_2gmh_B_614

255) chain B
residue 114
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence F
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

256) chain B
residue 125
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence V
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

257) chain B
residue 131
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence L
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

258) chain B
residue 133
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence M
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

259) chain B
residue 260-262
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence HTV
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

260) chain B
residue 271-274
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence YGGS
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

261) chain B
residue 362
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence P
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

262) chain B
residue 364
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence I
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

263) chain B
residue 421-422
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence IR
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

264) chain B
residue 425
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence C
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

265) chain B
residue 431
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence V
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

266) chain B
residue 434-436
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence GMI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

267) chain B
residue 438-440
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence TGI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

268) chain B
residue 443-444
type binding
ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE
sequence WI
description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site
source pdb_hetatom : UQ5_2gmh_B_615

269) chain B
residue 128-130
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence LPG
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_B_620

270) chain B
residue 443
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence W
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_B_620

271) chain B
residue 446
type binding
ligand EDO: 1,2-ETHANEDIOL
sequence R
description 1,2-ETHANEDIOL binding site
source pdb_hetatom : EDO_2gmh_B_620

272) chain B
residue 440-441
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence IF
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_B_618

273) chain B
residue 445
type binding
ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL
sequence F
description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site
source pdb_hetatom : BHG_2gmh_B_618

274) chain B
residue 504
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence L
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

275) chain B
residue 527-530
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence FCPA
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

276) chain B
residue 532-533
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence VY
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

277) chain B
residue 553-559
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence CVHCKTC
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613

278) chain B
residue 570
type binding
ligand SF4: IRON/SULFUR CLUSTER
sequence W
description IRON/SULFUR CLUSTER binding site
source pdb_hetatom : SF4_2gmh_B_613


Display surface

Download
Links