eF-site ID 2gmh-A PDB Code 2gmh Chain A click to enlarge Title Structure of Porcine Electron Transfer Flavoprotein-Ubiquinone Oxidoreductase in Complexed with Ubiquinone Classification OXIDOREDUCTASE Compound Electron transfer flavoprotein-ubiquinone oxidoreductase Source ORGANISM_COMMON: pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence A:  CKVPRITTHYTIYPRDQDKRWEGVNMERFAEEADVVIVGA GPAGLSAATRLKQLAAQHEKDLRVCLVEKAAHIGAHTLSG ACLDPRAFEELFPDWKEKGAPLNTPVTEDRFGILTEKYRI PVPILPGLPMNNHGNYVVRLGHLVSWMGEQAEALGVEVYP GYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLE LHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLK ELWVIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGE PLLALGFVVGLDYQNPYLSPFREFQRWKHHPSIKPTLEGG KRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPK IKGTHTAMKSGTLAAESIFNQLTSENLQSKTIGLHVTEYE DNLKNSWVWKELYSVRNIRPSCHGILGVYGGMIYTGIFYW IFRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISF DLLSSVALSGTNHEHDQPAHLTLKDDSVPVNRNLSIYDGP EQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKD PSQNINWVVPEGGGGPAYNGM Description (1)  Electron transfer flavoprotein-ubiquinone oxidoreductase (E.C.1.5.5.1) Functional site 1) chain A residue 424 type ligand sequence S description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 2) chain A residue 441 type ligand sequence F description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 3) chain A residue 445 type ligand sequence F description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 4) chain A residue 448 type ligand sequence M description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 5) chain A residue 450 type ligand sequence P description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 6) chain A residue 451 type ligand sequence W description BINDING SITE FOR RESIDUE BHG A 616 source : AC1 7) chain A residue 128 type ligand sequence L description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 8) chain A residue 129 type ligand sequence P description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 9) chain A residue 130 type ligand sequence G description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 10) chain A residue 269 type ligand sequence H description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 11) chain A residue 428 type ligand sequence I description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 12) chain A residue 443 type ligand sequence W description BINDING SITE FOR RESIDUE BHG A 617 source : AC2 13) chain A residue 232 type ligand sequence N description BINDING SITE FOR RESIDUE NA A 1070 source : AC4 14) chain A residue 504 type ligand sequence L description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 15) chain A residue 528 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 16) chain A residue 553 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 17) chain A residue 554 type ligand sequence V description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 18) chain A residue 556 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 19) chain A residue 557 type ligand sequence K description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 20) chain A residue 559 type ligand sequence C description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 21) chain A residue 570 type ligand sequence W description BINDING SITE FOR RESIDUE SF4 A 610 source : AC5 22) chain A residue 41 type ligand sequence V description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 23) chain A residue 42 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 24) chain A residue 44 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 25) chain A residue 45 type ligand sequence P description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 26) chain A residue 46 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 27) chain A residue 71 type ligand sequence E description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 28) chain A residue 72 type ligand sequence K description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 29) chain A residue 79 type ligand sequence H description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 30) chain A residue 82 type ligand sequence S description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 31) chain A residue 83 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 32) chain A residue 84 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 33) chain A residue 85 type ligand sequence C description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 34) chain A residue 166 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 35) chain A residue 167 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 36) chain A residue 212 type ligand sequence A description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 37) chain A residue 213 type ligand sequence E description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 38) chain A residue 214 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 39) chain A residue 218 type ligand sequence H description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 40) chain A residue 219 type ligand sequence L description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 41) chain A residue 331 type ligand sequence R description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 42) chain A residue 353 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 43) chain A residue 354 type ligand sequence C description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 44) chain A residue 364 type ligand sequence I description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 45) chain A residue 365 type ligand sequence K description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 46) chain A residue 366 type ligand sequence G description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 47) chain A residue 367 type ligand sequence T description BINDING SITE FOR RESIDUE FAD A 611 source : AC6 48) chain A residue 114 type ligand sequence F description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 49) chain A residue 133 type ligand sequence M description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 50) chain A residue 260 type ligand sequence H description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 51) chain A residue 262 type ligand sequence V description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 52) chain A residue 271 type ligand sequence Y description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 53) chain A residue 272 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 54) chain A residue 273 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 55) chain A residue 274 type ligand sequence S description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 56) chain A residue 364 type ligand sequence I description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 57) chain A residue 434 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 58) chain A residue 435 type ligand sequence M description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 59) chain A residue 438 type ligand sequence T description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 60) chain A residue 439 type ligand sequence G description BINDING SITE FOR RESIDUE UQ5 A 612 source : AC7 61) chain A residue 480 type ligand sequence Q description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 62) chain A residue 497 type ligand sequence E description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 63) chain A residue 574 type ligand sequence E description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 64) chain A residue 577 type ligand sequence G description BINDING SITE FOR RESIDUE EDO A 619 source : BC2 65) chain A residue 489 type ligand sequence V description BINDING SITE FOR RESIDUE EDO A 621 source : BC4 66) chain A residue 490 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 621 source : BC4 67) chain A residue 494 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 621 source : BC4 68) chain A residue 12 type ligand sequence H description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 69) chain A residue 13 type ligand sequence Y description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 70) chain A residue 168 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 71) chain A residue 218 type ligand sequence H description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 72) chain A residue 571 type ligand sequence V description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 73) chain A residue 572 type ligand sequence V description BINDING SITE FOR RESIDUE EDO A 622 source : BC5 74) chain A residue 9 type ligand sequence I description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 75) chain A residue 10 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 76) chain A residue 11 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 77) chain A residue 12 type ligand sequence H description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 78) chain A residue 502 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 79) chain A residue 504 type ligand sequence L description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 80) chain A residue 505 type ligand sequence T description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 81) chain A residue 548 type ligand sequence I description BINDING SITE FOR RESIDUE EDO A 623 source : BC6 82) chain A residue 324 type ligand sequence K description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 83) chain A residue 325 type ligand sequence R description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 84) chain A residue 483 type ligand sequence F description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 85) chain A residue 493 type ligand sequence G description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 86) chain A residue 495 type ligand sequence N description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 87) chain A residue 580 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 624 source : BC7 88) chain A residue 268 type ligand sequence R description BINDING SITE FOR RESIDUE EDO A 625 source : BC8 89) chain A residue 525 type ligand sequence Q description BINDING SITE FOR RESIDUE EDO A 626 source : BC9 90) chain A residue 280 type ligand sequence N description BINDING SITE FOR RESIDUE EDO A 627 source : CC1 91) chain A residue 282 type ligand sequence G description BINDING SITE FOR RESIDUE EDO A 627 source : CC1 92) chain A residue 32 type ligand sequence F description BINDING SITE FOR RESIDUE EDO A 628 source : CC2 93) chain A residue 33 type ligand sequence A description BINDING SITE FOR RESIDUE EDO A 628 source : CC2 94) chain A residue 528 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 95) chain A residue 553 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 96) chain A residue 556 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 97) chain A residue 559 type METAL ligand sequence C description Iron-sulfur (4Fe-4S) source Swiss-Prot : SWS_FT_FI1 98) chain A residue 272 type BINDING ligand sequence G description Ubiquinone; via carbonyl oxygen. source Swiss-Prot : SWS_FT_FI2 99) chain A residue 273 type BINDING ligand sequence G description Ubiquinone; via amide nitrogen. source Swiss-Prot : SWS_FT_FI3 100) chain A residue 42-47 type NP_BIND ligand sequence GAGPAG description FAD. source Swiss-Prot : SWS_FT_FI4 101) chain A residue 9-12 type binding ligand EDO: 1,2-ETHANEDIOL sequence ITTH description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 102) chain A residue 501-502 type binding ligand EDO: 1,2-ETHANEDIOL sequence PA description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 103) chain A residue 504-506 type binding ligand EDO: 1,2-ETHANEDIOL sequence LTL description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 104) chain A residue 548 type binding ligand EDO: 1,2-ETHANEDIOL sequence I description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_623 105) chain A residue 12-14 type binding ligand EDO: 1,2-ETHANEDIOL sequence HYT description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 106) chain A residue 167-169 type binding ligand EDO: 1,2-ETHANEDIOL sequence AAE description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 107) chain A residue 184 type binding ligand EDO: 1,2-ETHANEDIOL sequence N description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 108) chain A residue 218-219 type binding ligand EDO: 1,2-ETHANEDIOL sequence HL description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 109) chain A residue 571-573 type binding ligand EDO: 1,2-ETHANEDIOL sequence VVP description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_622 110) chain A residue 31-33 type binding ligand EDO: 1,2-ETHANEDIOL sequence RFA description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_628 111) chain A residue 41-47 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence VGAGPAG description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 112) chain A residue 70-73 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence VEKA description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 113) chain A residue 79-86 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence HTLSGACL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 114) chain A residue 143 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence L description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 115) chain A residue 165-167 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence YAA description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 116) chain A residue 212-215 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence AEGC description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 117) chain A residue 218-219 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence HL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 118) chain A residue 241-243 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence GLK description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 119) chain A residue 275 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence F description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 120) chain A residue 277 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence Y description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 121) chain A residue 291 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence V description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 122) chain A residue 331-333 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence RAL description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 123) chain A residue 352-355 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence IGCS description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 124) chain A residue 359 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence M description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 125) chain A residue 364-368 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence IKGTH description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 126) chain A residue 370 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence A description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 127) chain A residue 572 type binding ligand FAD: FLAVIN-ADENINE DINUCLEOTIDE sequence V description FLAVIN-ADENINE DINUCLEOTIDE binding site source pdb_hetatom : FAD_2gmh_A_611 128) chain A residue 114 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence F description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 129) chain A residue 125 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 130) chain A residue 131 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence L description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 131) chain A residue 133 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence M description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 132) chain A residue 260-262 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence HTV description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 133) chain A residue 271-275 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence YGGSF description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 134) chain A residue 291 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 135) chain A residue 362 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence P description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 136) chain A residue 364 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence I description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 137) chain A residue 421 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence I description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 138) chain A residue 425 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence C description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 139) chain A residue 431 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence V description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 140) chain A residue 434-436 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence GMI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 141) chain A residue 438-440 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence TGI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 142) chain A residue 443-444 type binding ligand UQ5: 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE sequence WI description 2,3-DIMETHOXY-5-METHYL-6-(3,11,15,19-TETRAMETHYL-EICOSA-2,6,10,14,18-PENTAENYL)-[1,4]BENZOQUINONE binding site source pdb_hetatom : UQ5_2gmh_A_612 143) chain A residue 128-131 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence LPGL description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_617 144) chain A residue 443-444 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence WI description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_617 145) chain A residue 446 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence R description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_617 146) chain A residue 253 type binding ligand EDO: 1,2-ETHANEDIOL sequence W description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_627 147) chain A residue 280-282 type binding ligand EDO: 1,2-ETHANEDIOL sequence NEG description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_627 148) chain A residue 267-268 type binding ligand EDO: 1,2-ETHANEDIOL sequence DR description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_625 149) chain A residue 432 type binding ligand EDO: 1,2-ETHANEDIOL sequence Y description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_625 150) chain A residue 424 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence S description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 151) chain A residue 427 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence G description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 152) chain A residue 437 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence Y description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 153) chain A residue 441 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence F description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 154) chain A residue 451 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence W description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 155) chain A residue 453 type binding ligand BHG: 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL sequence L description 2-HEXYLOXY-6-HYDROXYMETHYL-TETRAHYDRO-PYRAN-3,4,5-TRIOL binding site source pdb_hetatom : BHG_2gmh_A_616 156) chain A residue 486 type binding ligand EDO: 1,2-ETHANEDIOL sequence L description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 157) chain A residue 489-490 type binding ligand EDO: 1,2-ETHANEDIOL sequence VA description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 158) chain A residue 492-495 type binding ligand EDO: 1,2-ETHANEDIOL sequence SGTN description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 159) chain A residue 552 type binding ligand EDO: 1,2-ETHANEDIOL sequence N description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_621 160) chain A residue 493-495 type binding ligand EDO: 1,2-ETHANEDIOL sequence GTN description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_624 161) chain A residue 580 type binding ligand EDO: 1,2-ETHANEDIOL sequence A description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_624 162) chain A residue 495-497 type binding ligand EDO: 1,2-ETHANEDIOL sequence NHE description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_619 163) chain A residue 500 type binding ligand EDO: 1,2-ETHANEDIOL sequence Q description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_619 164) chain A residue 574-577 type binding ligand EDO: 1,2-ETHANEDIOL sequence EGGG description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_619 165) chain A residue 504 type binding ligand SF4: IRON/SULFUR CLUSTER sequence L description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 166) chain A residue 527-530 type binding ligand SF4: IRON/SULFUR CLUSTER sequence FCPA description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 167) chain A residue 532-533 type binding ligand SF4: IRON/SULFUR CLUSTER sequence VY description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 168) chain A residue 553-559 type binding ligand SF4: IRON/SULFUR CLUSTER sequence CVHCKTC description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 169) chain A residue 570 type binding ligand SF4: IRON/SULFUR CLUSTER sequence W description IRON/SULFUR CLUSTER binding site source pdb_hetatom : SF4_2gmh_A_610 170) chain A residue 517 type binding ligand EDO: 1,2-ETHANEDIOL sequence L description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 171) chain A residue 521 type binding ligand EDO: 1,2-ETHANEDIOL sequence D description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 172) chain A residue 525 type binding ligand EDO: 1,2-ETHANEDIOL sequence Q description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 173) chain A residue 535 type binding ligand EDO: 1,2-ETHANEDIOL sequence F description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626 174) chain A residue 544 type binding ligand EDO: 1,2-ETHANEDIOL sequence F description 1,2-ETHANEDIOL binding site source pdb_hetatom : EDO_2gmh_A_626

Display surface Download Links