eF-site ID 2gll-A PDB Code 2gll Chain A click to enlarge Title Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase(FabZ) from Helicobacter pylori Classification LYASE Compound (3R)-hydroxymyristoyl-acyl carrier protein dehydratase Source Helicobacter pylori (Campylobacter pylori) (Q5G940_HELPY) Sequence A:  LQSQFFIEHILQILPHRYPMLLVDRITELQANQKIVAYKN ITFNEDVFNGHFPNKPIFPGVLIVEGMAQSGGFLAFTSLW GFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLEYHLEVLK HKGMIWQVGGTAQVDGKVVAEAELKAMIAERE Description Functional site 1) chain A residue 58 type sequence H description BINDING SITE FOR RESIDUE CL A 1001 source : AC1 2) chain A residue 67 type sequence G description BINDING SITE FOR RESIDUE CL A 1001 source : AC1 3) chain A residue 138 type sequence T description BINDING SITE FOR RESIDUE BEN A 2001 source : AC7 4) chain A residue 145 type sequence V description BINDING SITE FOR RESIDUE BEN A 2001 source : AC7 5) chain A residue 148 type sequence E description BINDING SITE FOR RESIDUE BEN A 2001 source : AC7 6) chain A residue 40 type sequence Q description BINDING SITE FOR RESIDUE BEN E 2005 source : BC4 7) chain A residue 124 type sequence E description BINDING SITE FOR RESIDUE BEN E 2005 source : BC4 8) chain A residue 125 type sequence V description BINDING SITE FOR RESIDUE BEN E 2005 source : BC4 9) chain A residue 131 type sequence M description BINDING SITE FOR RESIDUE BEN F 2008 source : BC5 10) chain A residue 154 type sequence M description BINDING SITE FOR RESIDUE BEN F 2008 source : BC5 11) chain A residue 155 type sequence I description BINDING SITE FOR RESIDUE BEN F 2008 source : BC5 12) chain A residue 58 type ACT_SITE sequence H description ACT_SITE => ECO:0000255|HAMAP-Rule:MF_00406 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links