eF-site ID 2gj4-A PDB Code 2gj4 Chain A click to enlarge Title Structure of rabbit muscle glycogen phosphorylase in complex with ligand Classification TRANSFERASE Compound Glycogen phosphorylase, muscle form Source ORGANISM_COMMON: rabbit; ORGANISM_SCIENTIFIC: Oryctolagus cuniculus; Sequence A:  QISVRGLAGVENVTELKKNFNRHLHFTLVKDRNVATPRDY YFALAHTVRDHLVGRWIRTQQHYYEKDPKRIYYLSLEFYM GRTLQNTMVNLALENACDEATYQLGLDMEELEEIEEDAGL GNGGLGRLAACFLDSMATLGLAAYGYGIRYEFGIFNQKIC GGWQMEEADDWLRYGNPWEKARPEFTLPVHFYGRVEHTSQ GAKWVDTQVVLAMPYDTPVPGYRNNVVNTMRLWSAKAPNG YIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFVVA ATLQDIIRRFKSNFDAFPDKVAIQLNDTHPSLAIPELMRV LVDLERLDWDKAWEVTVKTCAYTNHTVLPEALERWPVHLL ETLLPRHLQIIYEINQRFLNRVAAAFPGDVDRLRRMSLVE EGAVKRINMAHLCIAGSHAVNGVARIHSEILKKTIFKDFY ELEPHKFQNKTNGITPRRWLVLCNPGLAEIIAERIGEEYI SDLDQLRKLLSYVDDEAFIRDVAKVKQENKLKFAAYLERE YKVHINPNSLFDVQVKRIHEYKRQLLNCLHVITLYNRIKK EPNKFVVPRTVMIGGKAAPGYHMAKMIIKLITAIGDVVNH DPVVGDRLRVIFLENYRVSLAEKVIPAADLSEQISTAGTE ASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENFFIFG MRVEDVDRLDQRGYNAQEYYDRIPELRQIIEQLSSGFFSP KQPDLFKDIVNMLMHHDRFKVFADYEEYVKCQERVSALYK NPREWTRMVIRNIATSGKFSSDRTIAQYAREIWGVEPSRQ RLP Description Functional site 1) chain A residue 67 type sequence W description BINDING SITE FOR RESIDUE SO4 A 941 source : AC1 2) chain A residue 71 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 941 source : AC1 3) chain A residue 193 type sequence R description BINDING SITE FOR RESIDUE SO4 A 941 source : AC1 4) chain A residue 215 type sequence W description BINDING SITE FOR RESIDUE SO4 A 942 source : AC2 5) chain A residue 351 type sequence R description BINDING SITE FOR RESIDUE SO4 A 942 source : AC2 6) chain A residue 219 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 943 source : AC3 7) chain A residue 221 type sequence V description BINDING SITE FOR RESIDUE SO4 A 943 source : AC3 8) chain A residue 272 type sequence A description BINDING SITE FOR RESIDUE SO4 A 943 source : AC3 9) chain A residue 275 type sequence I description BINDING SITE FOR RESIDUE SO4 A 943 source : AC3 10) chain A residue 294 type sequence K description BINDING SITE FOR RESIDUE SO4 A 943 source : AC3 11) chain A residue 37 type sequence F description BINDING SITE FOR RESIDUE SO4 A 944 source : AC4 12) chain A residue 62 type sequence H description BINDING SITE FOR RESIDUE SO4 A 944 source : AC4 13) chain A residue 549 type sequence L description BINDING SITE FOR RESIDUE SO4 A 945 source : AC5 14) chain A residue 553 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 945 source : AC5 15) chain A residue 643 type sequence I description BINDING SITE FOR RESIDUE SO4 A 945 source : AC5 16) chain A residue 644 type sequence F description BINDING SITE FOR RESIDUE SO4 A 945 source : AC5 17) chain A residue 645 type sequence L description BINDING SITE FOR RESIDUE SO4 A 945 source : AC5 18) chain A residue 646 type sequence E description BINDING SITE FOR RESIDUE SO4 A 945 source : AC5 19) chain A residue 706 type sequence E description BINDING SITE FOR RESIDUE SO4 A 946 source : AC6 20) chain A residue 708 type sequence F description BINDING SITE FOR RESIDUE SO4 A 946 source : AC6 21) chain A residue 709 type sequence F description BINDING SITE FOR RESIDUE SO4 A 946 source : AC6 22) chain A residue 786 type sequence R description BINDING SITE FOR RESIDUE SO4 A 946 source : AC6 23) chain A residue 519 type sequence R description BINDING SITE FOR RESIDUE SO4 A 947 source : AC7 24) chain A residue 702 type sequence E description BINDING SITE FOR RESIDUE SO4 A 947 source : AC7 25) chain A residue 703 type sequence A description BINDING SITE FOR RESIDUE SO4 A 947 source : AC7 26) chain A residue 807 type sequence T description BINDING SITE FOR RESIDUE SO4 A 947 source : AC7 27) chain A residue 408 type sequence Q description BINDING SITE FOR RESIDUE SO4 A 948 source : AC8 28) chain A residue 411 type sequence L description BINDING SITE FOR RESIDUE SO4 A 948 source : AC8 29) chain A residue 412 type sequence N description BINDING SITE FOR RESIDUE SO4 A 948 source : AC8 30) chain A residue 415 type sequence A description BINDING SITE FOR RESIDUE SO4 A 948 source : AC8 31) chain A residue 90 type sequence Y description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 32) chain A residue 134 type sequence G description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 33) chain A residue 568 type sequence K description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 34) chain A residue 574 type sequence K description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 35) chain A residue 648 type sequence Y description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 36) chain A residue 649 type sequence R description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 37) chain A residue 650 type sequence V description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 38) chain A residue 675 type sequence G description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 39) chain A residue 676 type sequence T description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 40) chain A residue 677 type sequence G description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 41) chain A residue 680 type sequence K description BINDING SITE FOR RESIDUE PLR A 940 source : AC9 42) chain A residue 38 type sequence T description BINDING SITE FOR RESIDUE 2TH A 949 source : BC1 43) chain A residue 40 type sequence V description BINDING SITE FOR RESIDUE 2TH A 949 source : BC1 44) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE 2TH A 949 source : BC1 45) chain A residue 60 type sequence R description BINDING SITE FOR RESIDUE 2TH A 949 source : BC1 46) chain A residue 67 type sequence W description BINDING SITE FOR RESIDUE 2TH A 949 source : BC1 47) chain A residue 190 type sequence E description BINDING SITE FOR RESIDUE 2TH A 949 source : BC1 48) chain A residue 191 type sequence K description BINDING SITE FOR RESIDUE 2TH A 949 source : BC1 49) chain A residue 514 type MOD_RES sequence D description Phosphoserine => ECO:0000250|UniProtKB:P09812 source Swiss-Prot : SWS_FT_FI9 50) chain A residue 747 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P09812 source Swiss-Prot : SWS_FT_FI9 51) chain A residue 748 type MOD_RES sequence G description Phosphoserine => ECO:0000250|UniProtKB:P09812 source Swiss-Prot : SWS_FT_FI9 52) chain A residue 681 type MOD_RES sequence F description N6-(pyridoxal phosphate)lysine => ECO:0000269|PubMed:7500360, ECO:0000269|PubMed:8976550, ECO:0007744|PDB:2PRI, ECO:0007744|PDB:2SKC, ECO:0007744|PDB:2SKD, ECO:0007744|PDB:2SKE source Swiss-Prot : SWS_FT_FI10 53) chain A residue 43 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P11217 source Swiss-Prot : SWS_FT_FI1 54) chain A residue 310 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P11217 source Swiss-Prot : SWS_FT_FI1 55) chain A residue 76 type BINDING sequence E description BINDING => ECO:0000269|PubMed:3616621 source Swiss-Prot : SWS_FT_FI2 56) chain A residue 109 type SITE sequence D description Involved in the association of subunits => ECO:0000303|PubMed:728424 source Swiss-Prot : SWS_FT_FI3 57) chain A residue 143 type SITE sequence F description Involved in the association of subunits => ECO:0000303|PubMed:728424 source Swiss-Prot : SWS_FT_FI3 58) chain A residue 156 type SITE sequence G description Can be labeled by an AMP analog; may be involved in allosteric regulation => ECO:0000303|PubMed:728424 source Swiss-Prot : SWS_FT_FI4 59) chain A residue 15 type MOD_RES sequence V description Phosphoserine; by PHK; in form phosphorylase A => ECO:0000250|UniProtKB:P11217 source Swiss-Prot : SWS_FT_FI5 60) chain A residue 204 type MOD_RES sequence G description Phosphotyrosine => ECO:0000250|UniProtKB:P09812 source Swiss-Prot : SWS_FT_FI6 61) chain A residue 227 type MOD_RES sequence D description Phosphotyrosine => ECO:0000250|UniProtKB:P09812 source Swiss-Prot : SWS_FT_FI6 62) chain A residue 430 type MOD_RES sequence L description Phosphoserine => ECO:0000250|UniProtKB:Q9WUB3 source Swiss-Prot : SWS_FT_FI7 63) chain A residue 473 type MOD_RES sequence E description Phosphotyrosine => ECO:0000250|UniProtKB:Q9WUB3 source Swiss-Prot : SWS_FT_FI8 64) chain A residue 672-684 type prosite sequence EASGTGNMKFMLN description PHOSPHORYLASE Phosphorylase pyridoxal-phosphate attachment site. EASGtGnMKfmLN source prosite : PS00102 65) chain A residue 378 type catalytic sequence T description 205 source MCSA : MCSA1 66) chain A residue 569 type catalytic sequence R description 205 source MCSA : MCSA1 67) chain A residue 570 type catalytic sequence I description 205 source MCSA : MCSA1 68) chain A residue 575 type catalytic sequence R description 205 source MCSA : MCSA1 69) chain A residue 677 type catalytic sequence G description 205 source MCSA : MCSA1 70) chain A residue 681 type catalytic sequence F description 205 source MCSA : MCSA1

Display surface Download Links