eF-site ID 2gcn-A PDB Code 2gcn Chain A click to enlarge Title Crystal structure of the human RhoC-GDP complex Classification SIGNALING PROTEIN Compound Rho-related GTP-binding protein RhoC Source null (RHOC_HUMAN) Sequence A:  AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENY IADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILM CFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLR QDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAK TKEGVREVFEMATRAGL Description Functional site 1) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE MG A 2001 source : AC1 2) chain A residue 37 type sequence T description BINDING SITE FOR RESIDUE MG A 2001 source : AC1 3) chain A residue 15 type sequence A description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 4) chain A residue 16 type sequence C description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 5) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 6) chain A residue 18 type sequence K description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 7) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 8) chain A residue 20 type sequence C description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 9) chain A residue 30 type sequence F description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 10) chain A residue 35 type sequence V description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 11) chain A residue 118 type sequence K description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 12) chain A residue 120 type sequence D description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 13) chain A residue 121 type sequence L description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 14) chain A residue 160 type sequence S description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 15) chain A residue 161 type sequence A description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 16) chain A residue 162 type sequence K description BINDING SITE FOR RESIDUE GDP A 1001 source : AC2 17) chain A residue 154 type sequence F description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 18) chain A residue 163 type sequence T description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 19) chain A residue 165 type sequence E description BINDING SITE FOR RESIDUE EDO A 3001 source : AC3 20) chain A residue 122 type sequence R description BINDING SITE FOR RESIDUE EDO A 3002 source : AC4 21) chain A residue 177 type sequence A description BINDING SITE FOR RESIDUE EDO A 3002 source : AC4 22) chain A residue 178 type sequence G description BINDING SITE FOR RESIDUE EDO A 3002 source : AC4 23) chain A residue 179 type sequence L description BINDING SITE FOR RESIDUE EDO A 3002 source : AC4 24) chain A residue 176 type sequence R description BINDING SITE FOR RESIDUE EDO A 3003 source : AC5 25) chain A residue 179 type sequence L description BINDING SITE FOR RESIDUE EDO A 3003 source : AC5 26) chain A residue 62 type sequence G description BINDING SITE FOR RESIDUE EDO A 3004 source : AC6 27) chain A residue 67 type sequence D description BINDING SITE FOR RESIDUE EDO A 3004 source : AC6 28) chain A residue 70 type sequence R description BINDING SITE FOR RESIDUE EDO A 3004 source : AC6 29) chain A residue 98 type sequence K description BINDING SITE FOR RESIDUE EDO A 3004 source : AC6 30) chain A residue 99 type sequence W description BINDING SITE FOR RESIDUE EDO A 3004 source : AC6 31) chain A residue 43 type sequence I description BINDING SITE FOR RESIDUE EDO A 3005 source : AC7 32) chain A residue 45 type sequence D description BINDING SITE FOR RESIDUE EDO A 3005 source : AC7 33) chain A residue 90 type sequence D description BINDING SITE FOR RESIDUE EDO A 3005 source : AC7 34) chain A residue 12 type BINDING sequence G description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 35) chain A residue 59 type BINDING sequence D description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 36) chain A residue 117 type BINDING sequence N description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 37) chain A residue 41 type MOD_RES sequence N description ADP-ribosylasparagine; by botulinum toxin => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 38) chain A residue 34 type CARBOHYD sequence Y description O-linked (GlcNAc) tyrosine; by Photorhabdus PAU_02230 => ECO:0000269|PubMed:24141704 source Swiss-Prot : SWS_FT_FI3 39) chain A residue 37 type CARBOHYD sequence T description (Microbial infection) O-linked (Glc) threonine; by C.difficile toxins TcdA and TcdB => ECO:0000269|PubMed:24905543 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links